DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and dnah6

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_012811375.1 Gene:dnah6 XenbaseID:XB-GENE-6050691 Length:4110 Species:Xenopus tropicalis

Alignment Length:4375 Identity:1342/4376 (31%)
Similarity:2180/4376 (50%) Gaps:579/4376 (13%)


  Fly   453 MGGLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRLSFKAKTDVMERMVSFQ 517
            :..||.|.|:.|.::::                 ::|.|..  |..|.   ||:....:|..:.:
 Frog    43 LSNLKDRIISLAPKQMV-----------------LNPQALG--FTHDT---KARAKTRKRQQAIK 85

  Fly   518 FE-----KGLEDTH-----------DLLLAGSLLLRPIIKK-----HVEPL-----MHVIVDDFE 556
            .:     |..:|.|           :|:..|.|......:|     .|||:     :..:.||.:
 Frog    86 LDPLPVLKVYQDHHQPEYIFQKNREELISRGVLHRSTSAEKGQRASSVEPISSPVRLPDLPDDLK 150

  Fly   557 EEIMCVKKEFINF------KNVFTALG-------LNELPT-------DDCFPKVSGAISFLKKLR 601
            |:.:  :.:|...      |...|||.       |:..|:       |....|:|..:..:|.::
 Frog   151 EKQL--QLDFCRIISPTPPKQPRTALSSANSYKRLSSPPSSTFETAEDVIKAKISDPLQMIKIVQ 213

  Fly   602 -HRIIGLHKEHELYEYPLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWTVECWQGIQQDITLTL 665
             ::.:|.     ||..|........|  |.:|:.:....:..|   :::......|:      |.
 Frog   214 ENKHLGF-----LYLTPAVPKSSIDY--DTYNLRIATHQNINK---NEYYTMSENGV------TH 262

  Fly   666 IEKDEANELRV-NFTERLIF--ALKDIKVVRLLGCDVSVNLTKFFCREDELWQARVKLMRIAEWY 727
            |...|...|.: .:.:..::  |||.|....|.      ...|.|    .:|:..|:..||.|. 
 Frog   263 ISDGEVLYLEIERWKQEYLYHKALKQIPTFALF------RKWKAF----TVWRKNVRAKRINEC- 316

  Fly   728 NDTFERAHPTEKRLIAAEMILIEEQMKPLLDFIKWNAF--SQRFIVMIFKMVKY-LHDRLVAAQE 789
                       ::.:...:.::.|.::|.:..|:...:  |...:..|.|...| ||:......:
 Frog   317 -----------RKALQENLFIVNEYLRPAILNIQEMCYRISDMGLCRIEKEYTYSLHEFTGNQLK 370

  Fly   790 NLEAI-----------KESIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAANAADTQRLIDL 843
            .||.:           ||.:||..:..|.: ....|...:|.......||:.|..|....    |
 Frog   371 QLEEVANRLSEFRDLAKEVVRSACRTALLE-AGFTPDEYMHDQITTGFLSMTAGPAVSDM----L 430

  Fly   844 LMYVNLKLFFDIPRRYSLPPGEHGEEDEE----------------------SDGIWPPIISLSVM 886
            |.:::.:||              ||..::                      :|.:....:.:..:
 Frog   431 LPHLDGELF--------------GESSDKMTYTEQANKRAHCRRLTCFIRLADYLIVNTMHILAV 481

  Fly   887 TSVK-----FKKKREVIDEEDDLEEFEEEQSE-SEEEIITPFHRYELLKGLSQEERALFREYEIY 945
            .||.     ..:|.:....:..::.:..::.| |.|:..|...:..:..|...||..:    .::
 Frog   482 NSVNTLLMYLVEKLKCTPSDTIIKTWNSQKQEASTEKKTTATQQLPIGPGGQIEEEVV----PMF 542

  Fly   946 VDEIIAENLVDSVITSSTYLRMEVDNRYENNTPIFEIFME--LQEPNVV---YFRNLDTSSKTGF 1005
            :.||:.:       |.:.:....:|:..||...:...|.|  |..||:|   ||.          
 Frog   543 LTEIVLD-------TQALWFEPSLDDFQENIAEVVNQFQEIVLSLPNLVPDSYFD---------- 590

  Fly  1006 AFFIETILDDMNNMMSLLKRVAQDPTEVTNMNPYSFYDELQDKSELDKQRVEIMNKIKLALQ--- 1067
            ||...||    ||.:. .|.....||..|      .:|:       ||....|:::||..:|   
 Frog   591 AFTKPTI----NNKLE-EKTCGDGPTLST------MFDD-------DKHLQTIISQIKETIQYAF 637

  Fly  1068 -AVRVHGKGFMEFSSLWIWDKSTYLSEVKK-------FGRNL---TLDERDAEADLEGSSGVKLL 1121
             |.:|:...|..|...:..:::..|..:||       |...|   ..:..||.| :..:..:.||
 Frog   638 DAAQVYAGTFERFLIFFKENENLDLEAMKKEEPGVDFFAEKLEKYNKEHNDALA-ITQNRNIGLL 701

  Fly  1122 GLEYPPLSVYKEQLDKFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQVGQWISLFKL---- 1182
            .::...|   ||:|     :....|..|...|....|....|.   ||:::...  :.|||    
 Frog   702 LIDAKKL---KEKL-----IPSPKRCLEAINDMLPILAKKKTD---AVIAEALD--AQFKLQSLP 753

  Fly  1183 ----DLINRVKNSLKELQDFV----DEANIV---------LKIELQKDDFEGLV----KILSVLN 1226
                |.:|.: ..|.|:|:.:    :|.|||         .|:....:||....    .|.:|.|
 Frog   754 TTTIDYVNSL-IFLDEIQERIEVLEEECNIVSHMYQLIDNYKVPTPPEDFAVYATLQPSITAVRN 817

  Fly  1227 QINEKQCIYDSMFDPL-----KEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQLIA 1286
            .|::.....|...:..     |:|.:|.::.....:..:..||.:|....:|||::.|....::.
 Frog   818 AIDKSVGERDGSIEKFCHSLDKDIAELNKEVKEVRQKAQDPQILDLAADQVKVKQILADLHTVLN 882

  Fly  1287 PIQSYQVDLIEKRILLCDNMANTYRKKFLSKKFFFVPCLSCYELIDESDLELVALEERQRSLAES 1351
            .:|:            |.....||:|.|..:       ::.||          |||         
 Frog   883 ELQT------------CAFQYKTYQKNFKVE-------VTKYE----------ALE--------- 909

  Fly  1352 AVLFELQGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGREL 1416
                          |:|. ::||.:::||.........::|.::.::.:|.|.::....|:.:..
 Frog   910 --------------EVCA-EVKLKQLLWDSLAEWDVLQDEWMQSNFEALDPEQVNSLVLKYAKFA 959

  Fly  1417 RGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVK-FSMDDSTTLKD 1480
            ..|:|.:........::..::|:...:..:|:|:||.::.|||..|.||.... ...:...:|:.
 Frog   960 TQLEKGLPPNNVVPLLKEKVENMKEKVPVITDLRNPFLKPRHWAALEQTINAALIDTEHPLSLQK 1024

  Fly  1481 LIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIH-DRTSIKLLKASEELIET 1544
            ||:::..:|.:.:::|..::..|.::|..::.:..:|...||....| |...:.:|..::::...
 Frog  1025 LIEIHAFDYAQAIQDISGQASGEASLETIIKKVEDSWKATEFTAIPHRDSKDVFILGGTDDIQVL 1089

  Fly  1545 LEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQL 1609
            |:|....:..:|||:|:...:..|..||.:||..::.:..|...||.|.|||||| .:.||:.||
 Frog  1090 LDDSIINISTIASSRYVGPIKSRVDEWQRQLSLFNETLDEWLTCQRNWLYLESIF-SAPDIQRQL 1153

  Fly  1610 PEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSGSKLYEHLEILLKMLLLCEKALNDYLETKRL 1674
            |.:::.|..:||.:|.::.::|...|.:|:..:.|  |.|..:....:|...:|.|..|||:||.
 Frog  1154 PAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPG--LLESFQNNNALLDQIQKCLEAYLESKRA 1216

  Fly  1675 SYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNL----------ISGSKNAAGMVAK 1729
            .:|||||:|:.:||:||:...||..|..||.|.:||:.||..          :..:.:...|::.
 Frog  1217 VFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSIAKLEFAVSPGEGEQEVVFTNDILAMLSP 1281

  Fly  1730 ELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHKPRHVWIFE-WPAQPALVG 1793
            |.|: |...:.....|.||.||.::.:.|..:||...|.::..|.:|.|..|:.. .|:|..|..
 Frog  1282 EGEK-VNLGKGLKARGNVEDWLGKVEEAMFASLRRLSKAAIADYQNKTRVEWVVAGHPSQVVLTI 1345

  Fly  1794 TQIMWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSR 1858
            :|:||..:.:.......:...::|.::.|....:||.|..|:.|.|....|..|..:.|||||:|
 Frog  1346 SQLMWCRDLSHCLEGECEDNLHSLAEFEKVNFERLNALAGLVRGHLPTLHRNIITALITIDVHAR 1410

  Fly  1859 DVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRC 1923
            |:|..::..||:...:|:||.|||:.||..:|:|.|.:..:|:.|.|||||..||||||||||||
 Frog  1411 DIVSDLVKDKVDSIESFEWQRQLRYYWDLDLDNCVARMALSQYTYAYEYLGACPRLVITPLTDRC 1475

  Fly  1924 YITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGA 1988
            |:.|..:|.|.:|||||||||||||||||||.:||.:...|||||:.:|||.:|....||||:||
 Frog  1476 YLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGA 1540

  Fly  1989 WGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAGRAEL 2053
            |.||||||||.:|||||:|.|:..|::|..||...|.|.|..|.|..|...|||||||||||.||
 Frog  1541 WCCFDEFNRIDIEVLSVIAQQLITIRNAKASKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTEL 1605

  Fly  2054 PENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAI 2118
            |:|||||:||.:|:||::|||:|::|.:|||:.:::||||...:|.||.|.||:|||||:|:||:
 Frog  1606 PDNLKALFRPFSMMVPNYALIAEVILYSEGFESSKVLARKMTQMYKLCSEQLSQQDHYDFGMRAV 1670

  Fly  2119 KSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFE 2183
            |||||:||:|:|::....||.||:|||||.|:||.:|||..:|.|:|.||||.:.:|.......:
 Frog  1671 KSVLVMAGSLKRENPNLNEDVVLIRALRDSNLPKFLTDDAELFSGIISDLFPGVHIPEHDYGTLQ 1735

  Fly  2184 AVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWK----TLNKTYQNQKR 2244
            :.|..:.::..|||....:.|::||.|...|||.|.::|..|.||:.|::    .|...::..:.
 Frog  1736 STIINAMINRGLQPVPSMVDKVIQLFETMIVRHGVMLVGPTGGGKTTVYQILADALGTLFKAGET 1800

  Fly  2245 KPHYN-----DLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPM 2304
            .|.|.     .||||::|..||:|.||..|.||||||.::.:|...|......|||:.||.:|.:
 Frog  1801 HPFYQLVKTYILNPKSITMGELYGEVNNLTLEWKDGLMALSVRAAVNDTSKDHKWIICDGPVDAL 1865

  Fly  2305 WIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFI 2369
            |||::|||:||||:|.||::|||..|.::.::||:..|:.|:||||||.|::||:.::|.|.|::
 Frog  1866 WIENMNTVLDDNKMLCLANSERIKFTPQIHMVFEVQDLKVASPATVSRCGMVYIDSEELKWMPYV 1930

  Fly  2370 QSW---LGTRTNSSEVSMLNVLFDKYVPPLLDIFRTR-LRSITPISDIARLQMTCYLLDSMLTPQ 2430
            |:|   |..:.|......:..|||:||...|.....: :::|:.: ||:::...|.||:|:|..:
 Frog  1931 QTWISGLSAKVNDILKEYVLALFDRYVEDGLKFVNKKCVQAISQV-DISKVTTLCCLLESLLLGK 1994

  Fly  2431 NVPNDCPKDWYEI------YFVFCIVWGFGSSLFQDQIIDWS--NEFSKWFLNEYKAVKFPLSGT 2487
            ..| |...|...:      .||||.:|..|.:|.::.   |.  :.|.:....:....|.|.||.
 Frog  1995 GGP-DLQMDPSRLNSIVCQTFVFCYLWSVGGNLTENY---WDAFDTFVRQQFEDNPEAKLPNSGD 2055

  Fly  2488 IFSFYIDHETKKFFPWTNLVPQFELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSG 2552
            ::|.|:|::||:..||..::|.|:...::|....||.|.:|.|..:.|:.|:...|.::..|.:|
 Frog  2056 LWSVYMDYDTKRLDPWERIIPSFKYSNNVPFFEMLVPTTDTVRYGYLMEKLLAVRHSVLFTGTTG 2120

  Fly  2553 SGKTILMNAKLSALPSDK-YSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVD 2616
            .||:::....|:.:..:. |....:.|:..|:|...|.|:|..||||.....|..||||:|.|||
 Frog  2121 VGKSVVARGLLNRIQEEAGYVPVYINFSAQTSSSRTQEIIESKLEKKRKTILGAPGNKRVIIFVD 2185

  Fly  2617 DMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIHKCNI-VACMNPSAGSFTIDPRLQRH 2680
            |:|||::|:|.:..|..|:||:.|:..:|||:||..::|....| .||..|..|...:.||..||
 Frog  2186 DLNMPKLDRYGSQPPIELLRQYQDFGGFYDREKMFWKEIQDVTIAAACAPPGGGRNPVTPRFIRH 2250

  Fly  2681 FCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIK 2745
            |....:..||:.:|..|..|||:..:.:    |.:||.:...|:|..|:.::.::....|||..|
 Frog  2251 FSMLCLPTPSEHSLKQIFQSILNGFLAD----FPEAVKQAATNIVDAAVEIYHRMSIDLLPTPAK 2311

  Fly  2746 FHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVR 2810
            .||.|||||::....|:|..:..:..:..|:.||:.|||.|::.|:|::..|...|.:::|::..
 Frog  2312 SHYVFNLRDLSKCVQGILQCDPGSVRDKTQIFRLFCHECQRIFHDRLINNEDKQYFHEMLSEMAS 2376

  Fly  2811 KGIEGVNDDVVY--AQPLIYCHFAK-GL--TDIKYMPISGWDRLKSLLDEAQDRYN-----DYIG 2865
            |.. .|..|..|  .:|:|:..|.| |:  .|..|..::..:::||:|.:..|.||     |   
 Frog  2377 KHF-AVQIDPEYFVTKPIIFGDFTKVGVDKADKVYEDLTDMEKIKSVLQDYLDDYNLTNAKD--- 2437

  Fly  2866 AMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVS 2930
             :.||.|.||:.||.||:|::...||.|||:||||:|||||||||:.|.....|||:|::.|:..
 Frog  2438 -VKLVFFQDAVEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCFQIELSRGYNYD 2501

  Fly  2931 DLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRN 2995
            ....::..||..|||:.....||.||::|                                    
 Frog  2502 SFHEDLRKLYKMAGVEDKNMVFLFTDTQV------------------------------------ 2530

  Fly  2996 EVKQLGIVDNRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQA 3060
                          ::|||.:||..|.:|||.||||...|.|.|.||:||||.|||||.:||::|
 Frog  2531 --------------FQYFISRVRQKLHIVLCMSPVGEAFRARCRMFPSLVNCCTIDWFVQWPKEA 2581

  Fly  3061 LESVSLRFLSEITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSK 3125
            |.|||.:|...|.:..:.:....|.....:|.:||.:::.|.:..:|..||||.|:||||.||..
 Frog  2582 LLSVSQKFFINIDLGSEGMKAKFSEMCVEIHMSVNTMAEKYYSELRRRYYTTPTSYLELINLYLS 2646

  Fly  3126 LLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENEKV 3190
            :|.||....:..|.|::|||.||......||.::..|...|..||.|:.:.|.|:..:..:.|..
 Frog  2647 MLGEKRNQLVSARDRVKNGLSKLLETNVLVDKMKVELSALEPVLKQKSVDVDALMEKLSVDQENA 2711

  Fly  3191 SKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPD 3255
            .:.|....::|...:...|:..|.|...:.|..:|.|||.||.:||::|:|.:::|::.|..|||
 Frog  2712 DQVRRIVKEDEAVAKVKAEETQAIADDAQRDLDEAMPALEAANKALDSLDKADISEIRVFTKPPD 2776

  Fly  3256 AVVSVCGAVLVLFSSKGKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIKALQPYILDA 3320
            .|::|..|:.:|.::|      ..|.|.:..:|: ..||..|:.|||::|.|.::..||.|:.:.
 Frog  2777 LVMTVMEAICILLNAK------PDWSAAKQLLGD-SNFLKRLLEYDKENIKPQILLKLQKYVNNP 2834

  Fly  3321 EFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTEL 3385
            :|.|||:...|.|...:|.||..::.:..|...||||::.|..::.|:......|.....:|..:
 Frog  2835 DFVPEKVEKVSKACRSMCMWVRAMDLYSRVLKDVEPKKQKLAAAQAELDATMSTLRDKQQKLKSV 2899

  Fly  3386 EEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPG 3450
            |||:.|||.:||::|::|:......:.|...::.|.:|...|..|::||.||:......|..:.|
 Frog  2900 EEQIKALQDQYDKSLSEKESLAKTMALTQARLNRAGKLTSALGDEQVRWKESIANFEEEISNVIG 2964

  Fly  3451 DILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGL 3515
            ::.|.:..::|.|.||..|||.|.: .|:.  |..:..||.:.......::.|..:|.:||..||
 Frog  2965 NVFIAAACVAYFGAFTAVYRQLLVD-CWIN--KCQELEIPISPNFSLINILGDAYEIRQWNTDGL 3026

  Fly  3516 PSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKTKYG-TGLVVLRLSQRNYLDQVERAVSNGSV 3579
            |.|.:|.||..::.:..|:|||||||.|..:|::.|.. .||.|::|:...:|..:|.|:..|..
 Frog  3027 PRDHISTENGILVTRGRRWPLMIDPQDQANRWIRNKENKNGLKVIKLTDAGFLRTLENAIRLGLP 3091

  Fly  3580 LLIENIGENIDPVLNPLLGRQLIKKG--TVLKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQT 3642
            :|:|.:.|.:||.|.|:|.:|....|  |::::||.:||::..||..:.||:.||||.||:..:.
 Frog  3092 VLLEELKETLDPALEPILSKQTFTSGGRTLIRLGDSDIDYDKNFRFYMTTKMPNPHYLPEVCIKV 3156

  Fly  3643 TLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVL 3707
            |:|||||||.|||||||::||::||||||..|.:|..:.|..|..||.:||.:|..|.::..|:|
 Frog  3157 TIINFTVTRSGLEDQLLSDVVRIERPDLEEQRNQLIIRINSDKNQLKAIEDRILKLLFTSEGNIL 3221

  Fly  3708 EDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQ 3772
            ::..|:..|:::|.|:..|:.::.||:.|...|::|||.|||.|.:.|:|||::..|.:|:|:||
 Frog  3222 DNEDLINTLQESKITSGAIKTRLLEAEATEENINTAREKYRPVATQGSVIYFVIASLSEIDPMYQ 3286

  Fly  3773 FSLKAFTVVFNNAMLKAMAAEKLKD---RVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQI 3834
            :|||.|..:||   :...||||..|   |:..|:....|.::...|||||||.|||:...||::|
 Frog  3287 YSLKYFKQLFN---MTIEAAEKSNDLDIRLATLLSQTLFSAYTNVSRGLFEQHKLIYSFMLCVEI 3348

  Fly  3835 LVNLGEVEPTELDFLLR--------FPYMPNQTSNFTWLTHVGWGGIRALNN-QAVFKGLEKDI- 3889
            :.:.||:..||.:|.||        .|..|:...    |:.|.|.....|.. ...|||::.:| 
 Frog  3349 MRHKGEISETEWNFFLRGAAGLDKERPTKPDVPG----LSDVLWYSCCDLEEILPCFKGIKNEIL 3409

  Fly  3890 --------------------EGSHKRWKKFVDSESPENEKFPGEWKGKSAIQRLCIMRCIRPDRM 3934
                                ||....|          |||.       :..|:|.:::....:::
 Frog  3410 STPVVIHLGSLEVHINTDFVEGPGSLW----------NEKL-------NLFQKLILIKTTVEEKV 3457

  Fly  3935 SYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHE 3999
            .:|:..|:...||.|:|:...::.:..:::.||.|.:.|:||.|.||:...::..|..|:|   |
 Frog  3458 VFAVTEFVINTLGKKFIENPPIDLATLYQDMSPSTPLIFILSTGSDPMGAFQRFAKERGYS---E 3519

  Fly  4000 NFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMESSLS---NVHTSYRLF 4061
            ...|:||||||..:||..|:.|.:.|||:.|||.||...|:..:|:.::|...   :::.::|||
 Frog  3520 RVQSISLGQGQGPIAEKMIKDAMKTGHWIFLQNCHLAVSWMLPMEELIKSFTEPNVSINENFRLF 3584

  Fly  4062 LSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSL 4126
            ||:.|     :...|..:|::::|:|||||.|:.||:.:|....:....|......:::.::|.:
 Frog  3585 LSSMP-----SRTFPVTVLQNSVKVTNEPPKGLRANVRRAFTEITTTFFEEHLLGRKWRKVIFGI 3644

  Fly  4127 CYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHIT 4191
            |:|||:|.||:||||.|||..|.||..|...::..|..|.:.. ::||:.|.|:.|||.|||.:|
 Frog  3645 CFFHAIVQERKKFGPLGWNICYEFNDSDRECALLNLNLYCQEG-KIPWDALLYITGEITYGGRVT 3708

  Fly  4192 DDWDRRLCRTYLEEFMQPELIDGELEYCQG----FPAPGILKYTGYHNYIDDNLP-SESPSLYGL 4251
            |.||:|..||.|..|..||.:  |..||..    :.:|.......:.:|| :||| ::.|.::|:
 Frog  3709 DAWDQRCLRTILRRFFSPETL--EDNYCYSTSGIYFSPDADSLQSFKDYI-ENLPLTDDPEIFGM 3770

  Fly  4252 HSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFN------ 4310
            |.||.:.|....:..|...:.::|||.| ...||:  |.::|::.:...||.|.|...:      
 Frog  3771 HENANLAFQRKETNTLINTILDVQPRST-TQGGGK--SNDEIVRELATSILSKLPDKLDMEVASE 3832

  Fly  4311 ---ILELMGRVEDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYM 4372
               :.:..|||...:   .|..||.:|.|.|:..||.||..|:..:.|.:.:|..||.:......
 Frog  3833 MLFVKDAKGRVNSLT---TVLGQEVDRFNKLLKVLKNSLETLNKAIAGLVVMSEEMEKIYKSFLN 3894

  Fly  4373 DQVPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTA 4437
            .|||..|:..||||:..|.||..||::|:..::.|:. ...|.|.|::|.|.||..||..:|..|
 Frog  3895 SQVPTLWSDAAYPSLKPLGSWVKDLVMRISFIDAWIR-IGQPKSFWISGLFFPQGFLTGTLQNHA 3958

  Fly  4438 RKNEWPLDRMCLNCDVTKKWKEELTT--------------------APREGAYINGLFMEGARWD 4482
            ||....:|.:..:.:|..:::::.|.                    ||.:|..::|::|:..|||
 Frog  3959 RKYNLAIDELNFHYNVLPQYRDQATVTEAMKTLKFGEELPMDAVLPAPEDGVLVHGMYMDACRWD 4023

  Fly  4483 MKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPVYKIRLRGPT---------FVWTFN 4538
            .:...|.||..:::.|.:||::.:. .|:.....::|:.|:||...|..|         ||.|..
 Frog  4024 DEAMVIEDALPRQMNPMLPVIHFEP-HQNYNPSGDLYQAPLYKTSARAGTLSTTGHSTNFVVTVL 4087

  Fly  4539 LKSRERASKWTLAGVCLLLQ 4558
            |.|..:...|...|..||.|
 Frog  4088 LPSNRQNDYWISKGSALLCQ 4107

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 64/360 (18%)
DHC_N2 1368..1770 CDD:285579 112/414 (27%)
P-loop_NTPase 1903..2132 CDD:304359 143/229 (62%)
P-loop_NTPase 2217..2352 CDD:304359 60/144 (42%)
P-loop_NTPase 2510..2783 CDD:304359 92/275 (33%)
P-loop_NTPase 2860..3127 CDD:304359 100/272 (37%)
MT 3140..3480 CDD:289543 105/340 (31%)
AAA_9 3509..3722 CDD:289547 91/216 (42%)
Dynein_heavy 3864..4549 CDD:281078 222/753 (29%)
dnah6XP_012811375.1 DHC_N2 914..1321 CDD:285579 111/411 (27%)
P-loop_NTPase 1455..1685 CDD:304359 143/230 (62%)
P-loop_NTPase 1769..1914 CDD:304359 61/145 (42%)
P-loop_NTPase 2078..2349 CDD:304359 92/275 (33%)
P-loop_NTPase 2430..2648 CDD:304359 100/272 (37%)
MT 2660..2992 CDD:289543 105/340 (31%)
AAA_9 3020..3236 CDD:289547 91/216 (42%)
Dynein_heavy 3377..4098 CDD:281078 223/762 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492at2759
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.