DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and dnah1

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_009304459.3 Gene:dnah1 ZFINID:ZDB-GENE-081015-3 Length:4175 Species:Danio rerio

Alignment Length:4411 Identity:1371/4412 (31%)
Similarity:2191/4412 (50%) Gaps:613/4412 (14%)


  Fly   451 IVMGGLKGRQITFALEKILEEYNSIYREWT-------------NIQYNP------IDPDA---EN 493
            :..||.|.......|:..|:.::::.::|.             ::.|.|      |.|..   ..
Zfish    68 LCQGGRKSNSCKTMLKTPLDLHSAMEKDWNGPGPQLQQETDFYSVSYTPKVQLPYICPPGHVPRK 132

  Fly   494 SLFQRDRLSFKAKTDVMERMVSFQFEKGLEDTHDLLLAGSLLLRPIIKKHVEP--LMHVIVDDFE 556
            ...:|.|..:: |.|: .:::|   |:|:....   |..|...|...|...:|  |...|.|:  
Zfish   133 IEIERRRREYQ-KLDI-SKLLS---EQGINSNQ---LIPSNQTRTETKNQPDPNYLSLEIFDN-- 187

  Fly   557 EEIMCVKKEFINFKNVFTALG-----LNE--------LPTDDCFPKV---SGAISFLKKLRHRII 605
            ||..|...|      .:.|||     :|.        |||.:..|.|   |.|:.:    ..:.:
Zfish   188 EEFDCRTPE------EWLALGYEPGSMNRKPIPAKALLPTKNSIPPVDPQSPAVEY----SWQSV 242

  Fly   606 G-LHKEHELYEYPLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWTVECWQGIQQDITLTLIEKD 669
            | |....|..:|.:...:..|:|.|.....:........:||:.   :.|  :.:...|...|..
Zfish   243 GVLRYSQEKKQYLVHKADCNGWVRDFMGNPILNGGQREGVLLES---QYW--VPRIRLLFCAEDP 302

  Fly   670 EANELRVNFTERLIFALKDIKVVRLLGCDVSVNLTKFFCRED----ELWQARVKLMRIAEWYNDT 730
            .....||.|.|.|                          |::    .|:...|..|.:  |:   
Zfish   303 RVFAQRVQFAENL--------------------------RQNTEASNLYHHSVDCMPV--WH--- 336

  Fly   731 FERAHPT-----EKRLIAAEMILI------EEQMKPLLDFIKWNAFSQRFIVMIF-KMVKYLHDR 783
               .|||     .|..::...:.:      |:|::..|:.    .:|:....|.| |:|:...:.
Zfish   337 ---LHPTSLERIRKYALSTSGLQLKCLQECEKQLEKELNL----EYSRTLNQMCFNKVVQDKPED 394

  Fly   784 LVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHT-DPREPILSIRAANAADTQRLIDLLMYV 847
            :...|...|:|.|  |.:..||.:..:....|.:.:: ..:..::::.:....:..|:.:     
Zfish   395 ITLPQTQPESIPE--RGFVSVPNYPFEKNRAAFVFNSLLTKAEVIAVLSRVREECNRVAE----- 452

  Fly   848 NLKLFFDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQS 912
             :.||:                                   |.|.|...       |||||..||
Zfish   453 -MSLFY-----------------------------------VSFTKSLR-------LEEFESAQS 474

  Fly   913 ESEEEIITPFHRY-------ELLKGLS---QEER-----------------------ALFREYEI 944
            :...:|    |.:       .|..|:|   ::||                       ||.|  .:
Zfish   475 QKHSQI----HLFLEESWLPALCNGISSNLRDERCSWYNLAVSRCDVYRMSKLCRLMALIR--SL 533

  Fly   945 YVDEIIAENLVDSVITSSTYLRME------------------VDNRYE-NNTPIFEIFMELQEPN 990
            ..|.:  ..||...:.|.|.|.::                  :::.|: ...|:|.:.:.|.:..
Zfish   534 QQDSL--RFLVQGSLASLTKLILDACHSVLQCPQELTWGPDLINSPYKPKKKPLFSVDLVLDQTG 596

  Fly   991 VVYFRNLDTSSKTGFAFFIETILDDMN----------NMM---SLLKRVAQDPTEVTNMNPYSFY 1042
            |.|...|::...:....|.:.||...|          |:.   .:|..|.....||.|:      
Zfish   597 VHYSTPLESFETSVINLFDKGILSTHNVPQVDKFVLPNLFIVGEVLWSVGLWEPEVKNL------ 655

  Fly  1043 DELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEVKKFGRNLTLDERD 1107
                        |..|...:|.|:..::.:.:.:..:..|:..|.:|||.          |..::
Zfish   656 ------------RESISKALKQAIIPLKAYTREYECYLELYNSDVNTYLE----------LHSQE 698

  Fly  1108 AEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQ 1172
            .:.                |..|.:|.|:..:|::                .||.:.....::..
Zfish   699 NQT----------------PQEVKQEVLEHLMEVE----------------HLNKSIPSAIIIGP 731

  Fly  1173 VGQWISLFKLDLINRVKNSLK------------ELQDFVDEANIVLKIELQK-DDFEGLVKILSV 1224
            ....:...:..|:.:.|...|            ::||...|...:.|...:| ...|.|.:....
Zfish   732 FMVNVEAIRQSLVKKRKGLAKALLDRLALRLRQQMQDACKECKAISKKLFEKPSSIEELTEQREW 796

  Fly  1225 LNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKRLAATTKQL--IAP 1287
            :||:.|:...::.:........||:.::.|...|.|..:         |...:|...|.|  :..
Zfish   797 MNQVPEQLKAHEEILSKAMSDYDLIDEFYYSLSDEEFKE---------KWSAMAWPHKILTQMET 852

  Fly  1288 IQSYQVDLIEK--RILLCDNMANTYRKKFLSKKFFFVPCLSCYELIDESDLELVALEERQ----- 1345
            :.:..||..|:  :|.:.|..:...|..||.   ..|...|.|..::.:  ..||.|.|:     
Zfish   853 VSAQHVDDEERFDKIQVADQNSFLERLSFLE---MVVAGFSGYTNLERA--HEVANEVRRVGKQL 912

  Fly  1346 RSLAESAVLF----ELQGPDPV----KIELCRFDLKLVKIMWDFAITIQSTINDWKK-------T 1395
            :...|.|.|:    .|.| .||    :::....|.:....:|       .|.:||.:       .
Zfish   913 KECQEMAQLYNNRERLFG-KPVTNYTELQKLNRDFQPFHDLW-------KTTSDWLRWHESWLND 969

  Fly  1396 PWKKIDIENMDQE--------------------CKKFGRELRGLDKAMRTWEPFIFMEASLKNLM 1440
            |...|:.|.:::.                    |::...|:|...:|.|   |||       .|:
Zfish   970 PLAAINPEQLERNVTDAYKTMHQCVKQFKDLPACQEVASEIRTKIEAFR---PFI-------PLI 1024

  Fly  1441 TSLRAVTELQNPAIRDRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMA 1505
            .|||      ||.:|:|||..|.:...:......:.|....::|.|.::.||:..:..::.||.:
Zfish  1025 RSLR------NPGMRNRHWELLSERININMRSRANLTFSLCLELGLQDHVEEITRVAQEAGKEYS 1083

  Fly  1506 MEKQLRDIATAWGTMEFGTDIHDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRL 1570
            :|:.|..:...|.|:.|....:..|...:||:.:|..:.|:||....|:||.|.|...||..:..
Zfish  1084 IEQALNKMEEEWSTVMFEVMPYKETGTYILKSPDEASQLLDDHIVMTQSMAFSPYKKPFEERISK 1148

  Fly  1571 WQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRN 1635
            |:::|....:::..|...||.|.|:|.|| .|:||..|||.:.:|:..:::.::.::...:.:..
Zfish  1149 WESKLKMTQEVLEEWLICQRSWLYMEPIF-SSDDINRQLPVEGKRYQTMERTWRNIMKAAHDNNR 1212

  Fly  1636 VVRSTNRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALV 1700
            |:.....  ::|...|:....:|.|.:|.|:|||||||.::|||||:|..:||:|||...:|..|
Zfish  1213 VIEVCPE--ARLLASLKDCNNLLELVQKGLSDYLETKRSAFPRFYFLSDDELLEILSQTKDPTSV 1275

  Fly  1701 ARHLTKLYDSMGKLN-----LISGSKNAAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRD 1760
            ..||.|.::::.:|:     ||:...::.|   :|:...||    ...:|.||.||..:.:.|:.
Zfish  1276 QPHLRKCFENIARLHFQSDLLITRMYSSEG---EEVHLSVP----VSPTGNVEHWLREVENSMKA 1333

  Fly  1761 TLRDQLKRSLTFYDHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQI 1825
            ::||.:.|||..|...||..|:..||.|..:.|.|..||.|.:::..|      ..|.|....|:
Zfish  1334 SVRDNISRSLQAYVEHPRTEWVLSWPGQVVIAGCQTFWTQEVSESLNK------GDLADRLYPQL 1392

  Fly  1826 -TQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKI 1889
             .||.:|:.|:.|.|:..:|..:..:..|:||::||...::.::|.....|:|.||||:.|.   
Zfish  1393 QKQLGDLVKLVRGQLSKMQRAILSALIVIEVHAKDVAAKLVEEEVSSVNDFEWISQLRYYWR--- 1454

  Fly  1890 DDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDL 1954
            .|.:....:|:|.|.||||||:.||||||||||||:|||.:|||..|||||||||||||||||||
Zfish  1455 HDLYIRAVNAEFLYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDL 1519

  Fly  1955 GRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKS 2019
            |:||.:...|||||:|:|:.::|...||||.:|||.||||||||.||||||||.|:..||.|.:.
Zfish  1520 GKALAIQTVVFNCSDQLDFIAMGKFLKGLASSGAWACFDEFNRIDVEVLSVVAQQITTIQKAQQQ 1584

  Fly  2020 KKQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGF 2084
            :.:||.|.|..|||.::..||||||||||||.|||:|||||:||.||::||:|:|:||.|.:.||
Zfish  1585 RVKTFVFEGMEIALVSSCAVFITMNPGYAGRTELPDNLKALFRPVAMMIPDYAMIAEISLYSFGF 1649

  Fly  2085 QEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFN 2149
            .:|::|::|..:.:.|..|.||.|||||:|:||:|:|:..||.|:|::....|:.:.:||:||.|
Zfish  1650 SDAKVLSKKITSTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPDMNEELICLRAIRDVN 1714

  Fly  2150 IPKIVTDDVPVFMGLIGDLFPALDVPRKRNP----EFEAVIKRSALDLKLQPEDGFILKIVQLEE 2210
            :||.:.||:.:|.|::.||||.:    :..|    ..:..|:....:..|:..||:|.|.:||.|
Zfish  1715 VPKFLQDDLKLFNGIVSDLFPKI----REEPIDYGTLDESIRNVCANKCLKDVDGYITKCIQLYE 1775

  Fly  2211 LFAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKRKPHYND----------LNPKAVTNDELFGIV 2265
            ...|||.:.::|.:|:||:..::.|.......|.:|..:.          ||||::|..:|:|..
Zfish  1776 TTVVRHGLMLVGPSGSGKTRCYEVLAAAMTALKGQPSVSGGEYEAVQTYVLNPKSITMGQLYGEF 1840

  Fly  2266 NPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALT 2330
            :..|.||.||:.|.|:||.|:......||.:.||.:|.:|||::|||:||||.|.|:|.|.|.|:
Zfish  1841 DQLTHEWTDGILSCLIRDGASSMEQEKKWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLS 1905

  Fly  2331 KEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSE--VSMLNVLFDKYV 2393
            ..|.::||:..|..|:||||||.|::|:.|..||.|||.:.||.|..:...  ...:|.||.:::
Zfish  1906 DAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLTPFTECWLRTIPDMFRPYADQINSLFTRFL 1970

  Fly  2394 PPLLDIFRTRLRSITPISDIARLQMTC---YLLDSMLTPQNVPNDCPK-----------DWYEIY 2444
            ...:...|..::.:....|   ..:||   .|||....| .:|.:..|           :..|.:
Zfish  1971 QDSIRFVRESIKEVITSMD---SNLTCSLLKLLDCFFQP-FIPREGKKPHSQEKLSRLQELIEPW 2031

  Fly  2445 FVFCIVWGFGSSLFQDQIIDWSNEFSKW----FLNEYKAVKFPLSGTIFSFYID----------- 2494
            |:|.::|..|::...:.    ...||.|    .:.|...:.||..|.::.:.:|           
Zfish  2032 FIFALIWSVGATGDANS----CQRFSVWLRGKMVEEKIQLCFPEEGAVYDYNLDDAGISCFDDED 2092

  Fly  2495 ---HETK-KFFPWTNLVPQFELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGK 2555
               .|.| ::..|.....:..:..:......:|.|.:|.|:.|.:|.|:...:|::.|||:|:||
Zfish  2093 GEGKERKVQWVSWMKYAQEVVITPETRYSDIIVPTVDTVRMSFLIDMLLSNKNPVLCIGPTGTGK 2157

  Fly  2556 TILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNM 2620
            |:.::.||......:|....:.|:..|::...|..::..|:::....:||...|..|:|:||:||
Zfish  2158 TLTISDKLLKNMPAEYITHFLMFSARTSANQTQDYIDSKLDRRRKGVFGPPLGKYFIFFIDDLNM 2222

  Fly  2621 PEVDKYFTVQPHTLIRQFMDYHHWYDRQKM-TLRDIHKCNIVACMNPSAGSFT-IDPRLQRHFCS 2683
            |.::.|....|..|:||:||:..||||::: |.:::...|....|.|..|... |..|..|||..
Zfish  2223 PMLETYGAQPPIELLRQWMDHGGWYDRKQIGTFKNLVDINFACAMGPPGGGRNPITQRFTRHFNF 2287

  Fly  2684 FAVNPPSQDALFHILNSILSQHMD-NPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFH 2747
            .:.......:...|.::||...|. .|..|      ..|:.:|...|.::..:.|:.|||..|.|
Zfish  2288 LSFTEMEDASKGKIFSTILGSWMQKTPEMK------PFCKPLVDATIRVYSTITSALLPTPAKSH 2346

  Fly  2748 YNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRK- 2811
            |.|||||::.:|.|:|.:.:....|..|:::||.||..||:.|:||...|.:.|.:::.:.::| 
Zfish  2347 YTFNLRDLSKVFQGILMAEAGKIENKIQLLQLWYHESCRVFQDRLVSEEDRSWFDQLLHNHIKKF 2411

  Fly  2812 GIEGVNDDVVYAQPLIYCHFA-KGLTDIKYMPISGWDRLKSLLDEAQDRYND-YIGAMNLVLFDD 2874
            |.|  .::||..||::|..|. .|...: |..|...::|..:::|..|.||. ....|.||||.|
Zfish  2412 GCE--IEEVVPYQPILYGDFMFPGAVKV-YQLIQDREKLARVMEEYLDDYNQTSTSKMKLVLFMD 2473

  Fly  2875 AMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATL 2939
            |:.|||||||||....|.|||:||||||:|||||||:.|:..:.|||:|:|:|.:.:.:.:|.::
Zfish  2474 AIQHVCRISRILRQPLGNALLLGVGGSGRQSLTRLATHIAEYECFQIELSKNYGLLEWREDIKSI 2538

  Fly  2940 YMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVD 3004
            .:|||::.....||..|:::..|.||..||::|.|||:..|:..:|.|.|:.|::..|:.:|...
Zfish  2539 MLKAGMQNVQITFLFVDTQIKSESFLEDVNNILNSGDVPNLYTSEEQERILTAMKPVVQDMGQQP 2603

  Fly  3005 NRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFL 3069
            .:.|....::.:|||.:..|||.||||...|.|.|:||:||||.|||||..|||:|||||:..||
Zfish  2604 TKANLMAAYVNRVRSNIHTVLCMSPVGEVFRARLRQFPSLVNCCTIDWFSAWPQEALESVATSFL 2668

  Fly  3070 SEITVL---PK---ELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLH 3128
            :|:..|   ||   .|||    ....:|:.|:...:.|||...|:|..||||:|||::::|.|:.
Zfish  2669 NELPELESNPKTIQSLAL----MCVEIHQMVSRKCEQYLAELSRHNSVTPKSYLELLSIFSSLIG 2729

  Fly  3129 EKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENEKVSKE 3193
            :|.:.....|.|::.||.||.|..::|..:|:.|::...:|:   :.|.:.:|.:    ||:.::
Zfish  2730 QKKQELHSARQRMKTGLDKLLSTAEDVAKMQEELEMMRPQLE---EAAKDTVITM----EKIKED 2787

  Fly  3194 RAFASKEEKNVRQIEEDVTAKAKL-------CEEDFLKAQPALIAAQEALNTLNKNNLTELKSFG 3251
            ...|.:....|:..|...|.||::       .::|..:|.|||.||..:|.:|.||::.|:::..
Zfish  2788 TVVAEETRVAVQAEETKATEKARVAQAIADDAQKDLNEALPALDAALASLQSLKKNDVVEVRAMQ 2852

  Fly  3252 SPPDAVVSVCGAVLVLFSSKGKIPK-----------DRSWKACRAFMGNVDKFLDNLINYDKKHI 3305
            .||..|..|..||.:|   ||..||           |..|.|.:..:.:..|||::|..|||.:|
Zfish  2853 RPPPGVKLVIEAVCIL---KGIKPKKVAGEKLGEKVDDYWDAGKGLLQDPGKFLESLFKYDKDNI 2914

  Fly  3306 HPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKE--- 3367
            ...|||.:|||:.:.||.|:.|...|.|...:|.||..::.::.|...||||.:||.|::::   
Zfish  2915 PDSVIKQVQPYMDNPEFHPDSIAKVSKACTSICQWVRAMHVYHFVARAVEPKRQALQEAQEDLAV 2979

  Fly  3368 ----VKDARDKLTALNLRLTELEEQLNALQMEYDEALAKK-------QKCQDEASKTAFTIDIAN 3421
                :.||:.||.|       :||.:..||.:|.|.|||:       |.|::...:       |:
Zfish  2980 TQRILDDAKGKLAA-------VEEGIATLQAKYHECLAKRDELDAKCQLCENRLIR-------AD 3030

  Fly  3422 RLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQ 3486
            :||||||.||:||.|:|:.|.:.:..:.||:|:.:.:::|:|.||..||..:.|: |:..||:. 
Zfish  3031 KLIGGLADEKVRWSETVQQLEYMVNNVAGDVLLAAGYVAYLGPFTGEYRSAMAEE-WLRGFKDL- 3093

  Fly  3487 PPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKT- 3550
             .:|.|:..:....:.|..:|..|...|||.|.:|.||..|...|:|:||.||||.|..||:|. 
Zfish  3094 -AVPHTEQPNLISTLGDKVKIRSWQIAGLPKDSLSVENGVIAQYSQRWPLFIDPQGQANKWIKNM 3157

  Fly  3551 KYGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLI--KKGTVLKIGDR 3613
            :....|.|::||.|::|..:|.|:..|...|:||:||.:||.|:|:|.||..  :..||||:||.
Zfish  3158 ERDNRLDVMKLSDRDFLRSLENAIRFGKPCLLENVGEELDPALDPVLLRQTYTHEGNTVLKLGDT 3222

  Fly  3614 EIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLT 3678
            .|.::..|::.:.|||.||||.||:..:.||||||::..|||||||..:|..||||||..:.:|.
Zfish  3223 IIHYHDDFKMYITTKLPNPHYSPEISTKVTLINFTLSPSGLEDQLLGRLVAEERPDLEGAKNQLI 3287

  Fly  3679 QQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSA 3743
            ......|..||.:||.:|.||||:..|.::|..|:..|..:|..|:||:.||..|:.|...||:.
Zfish  3288 VSNAQMKQELKEIEDQILFRLSSSEGNPVDDEELIKVLGASKVKAEEIQAKVTAAEATERDIDAT 3352

  Fly  3744 REAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITF 3808
            |..|.|.|.||.|::|.::||..::|:||:||:.|..:|...::.:..|:.:.:|:.|:.:..||
Zfish  3353 RLEYVPVAVRAQILFFCVSDLSNVDPMYQYSLEWFLGIFMGGIVNSKQADAVIERILNINEFFTF 3417

  Fly  3809 CSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLRFPYMPNQTSN--FTWLTHVGWG 3871
            ..:....|.|||:.||:|...||.:||.|..:::..|..::|.......||.|  ..||:...|.
Zfish  3418 SLYSNVCRSLFEKHKLMFAFLLCARILTNDSKIDMAEWRYMLSGGQTQQQTPNPAPNWLSTRAWQ 3482

  Fly  3872 GIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKGK-SAIQRLCIMRCIRPDRMS 3935
            .|.||:....|..|.:........:|...||..|..|..||||:.: .:.|:|.|:||:|.||::
Zfish  3483 DILALSALPSFSNLPQSFSKHESAFKSIFDSSQPHREPLPGEWESQLDSFQKLLILRCLRADRLT 3547

  Fly  3936 YAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHEN 4000
            :.::.|:..:||.::|:.::.:.|..|:||||.|.:.||||||.||..|:.|..:.:.||   :.
Zfish  3548 HGLQDFVSSQLGQRFIEPQTSDLSVVFKESSPSTPLIFVLSPGTDPAADLYKFAEIMKFS---KK 3609

  Fly  4001 FHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMES-SLSNVHTSYRLFLSA 4064
            .:::||||||...||..:..|.:.|.||..||.||...|:||||:.:|: ....||..:||:|::
Zfish  3610 MNAISLGQGQGPSAEVMMHSAMEKGKWVFFQNCHLAPSWMPSLERLIENIDPDKVHRDFRLWLTS 3674

  Fly  4065 EPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSLCYF 4129
            .|:..     .|..||::..|:|.|||.|:.||:.|...:.:::.:..|:|..|||::|.|||.|
Zfish  3675 LPSNK-----FPVSILQNGSKMTIEPPRGIKANLLKTYASVTEDFITSCTKTAEFKSLLLSLCLF 3734

  Fly  4130 HAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDW 4194
            |....|||||||.|:|..|.|..|||.|.:..|..:|:....:|::.|:|..|||.|||.:||:|
Zfish  3735 HGNAIERRKFGPLGFNIPYEFTDGDLNICISQLKMFLDEYQDIPYKVLKYTAGEINYGGRVTDNW 3799

  Fly  4195 DRRLCRTYLEEFMQPELIDGELEYC-----QGFPAPGILKYTGYHNYIDDNLP-SESPSLYGLHS 4253
            |||.....||:|.||.::.....|.     :..|....:|  ||..|. ..|| ::||.::|||.
Zfish  3800 DRRCILNILEDFYQPIVLSPHHIYSPSGDYRQIPTDNNVK--GYLTYF-RGLPINDSPEIFGLHD 3861

  Fly  4254 NAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILELMGR- 4317
            ||.|.|....:..|...:.:||||:  .:|||:  |:|:||:.|:|.|::|.|...|:.::|.: 
Zfish  3862 NANISFAQNETFALLGTLVKLQPRV--AASGGK--SREEIIEEIVEGIVEKIPDLINVQQVMNKY 3922

  Fly  4318 ---VEDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQW 4379
               .|:....::|  ||..|.|.|::.:.:||::|...|||.:.:||.:|.:...|:::.|||.|
Zfish  3923 PVMYEESMNTVLV--QEVIRYNRLLSVISQSLSDLVKALKGLVVMSSELELMSNSLFINAVPEIW 3985

  Fly  4380 TKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPL 4444
            ...||||:..|.||.|||:.|:..|:.|::| .:|:..|::|||.||:.||..:|..||.:...:
Zfish  3986 KAKAYPSLKPLASWVSDLVQRIGFLQNWISD-GIPAVFWISGFFFPQAFLTGTLQNFARGSVVSI 4049

  Fly  4445 DRMCLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVT 4509
            |.:..:..|.|:...|||..|..|.:|:|||:||||||...|.:|::..|||:..|.|:::..|.
Zfish  4050 DTIAFDFKVMKESVAELTERPDIGCFIHGLFLEGARWDADTGQLAESRPKELYTEMAVIWMVPVP 4114

  Fly  4510 QDKQDIKNVYECPVYKIRLRGPT---------FVWTFNLKSRERASKWTLAGVCLL 4556
            ..|.....||.||:||...|..|         :|....|.:......|...||.|:
Zfish  4115 NRKTPQSGVYLCPIYKTLTRAGTLSTTGHSTNYVIAVELPTDRTQGHWIKQGVALI 4170

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 69/368 (19%)
DHC_N2 1368..1770 CDD:285579 117/434 (27%)
P-loop_NTPase 1903..2132 CDD:304359 143/229 (62%)
P-loop_NTPase 2217..2352 CDD:304359 55/145 (38%)
P-loop_NTPase 2510..2783 CDD:304359 82/276 (30%)
P-loop_NTPase 2860..3127 CDD:304359 123/274 (45%)
MT 3140..3480 CDD:289543 118/372 (32%)
AAA_9 3509..3722 CDD:289547 95/216 (44%)
Dynein_heavy 3864..4549 CDD:281078 257/706 (36%)
dnah1XP_009304459.3 DHC_N2 946..1342 CDD:312039 115/429 (27%)
MT 1120..3808 CDD:330758 1010/2767 (37%)
Dynein_heavy 3474..4170 CDD:308587 260/714 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.