DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and dnah12

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_004914230.1 Gene:dnah12 XenbaseID:XB-GENE-494652 Length:3960 Species:Xenopus tropicalis

Alignment Length:4077 Identity:1300/4078 (32%)
Similarity:2033/4078 (50%) Gaps:501/4078 (12%)


  Fly   858 RYSLPPGEHGEEDEESDGIWPPI--------ISLSVMTSVKFKKKREVIDEEDD------LEEFE 908
            |.|.|||::      .:|..|||        |..:....:|.|:.:|.....:|      ::.:|
 Frog     6 RPSPPPGQN------LNGRLPPISIPVASPSIGANAKRIMKHKRSKEQQKTLNDIIINTAMKAYE 64

  Fly   909 EEQSESEEEIITPFHRYELLKGLSQEERALFREYEIYVDEIIAENLVDSVITSSTYLRMEVDNRY 973
            |.....:..:.|| ...:....::.|:|.|...|          ..:.|.:.||..  :.:.|.:
 Frog    65 ETMEAKKRRVPTP-PEPQYPSTMNSEQRQLRMNY----------YFMKSCVESSPV--VPIQNHW 116

  Fly   974 ENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMM--SLLKRVAQDPTEVTNM 1036
                  .|..:.|..|.:    ...||.::..:..::.:..|....|  .|::.|...| ||..:
 Frog   117 ------LEAMLTLVPPAL----KEGTSKESLISELMQEVSHDFEKSMRRHLVRSVLVKP-EVKGL 170

  Fly  1037 NPYSFYDELQDKSELD----------KQRVEIMNKIKLALQAVR-VHGKGFMEFSSLWIWDKSTY 1090
            ........|:....||          :.:.||...:.:...|:| :...|:..||.|.|.|.|.|
 Frog   171 EQEESGPLLESPVGLDFSKPWHKSFVQSKTEISKNLHILRPALRTMLDLGYSTFSQLLIADLSGY 235

  Fly  1091 LS----EVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPL-----------SVYKEQLDKFI- 1139
            .:    |......|:||....||.        |||...||.:           .|..|:.|.|. 
 Frog   236 RAKGPVECDSLKNNVTLSCSKAEE--------KLLSTWYPKVINLFTTNEALQLVRPEKTDSFYG 292

  Fly  1140 --------ELQDQI-RTWETY-------------------------EDFF---------VFLRLN 1161
                    :|:|.: ||.|::                         .||:         |...|.
 Frog   293 CVTTLMSNQLRDVLTRTVESFVKLFDTTNPQYLPLFKMELTFDDEKMDFYPSLEDLEESVLFMLT 357

  Fly  1162 MTGFKVAVLSQVGQWIS------------------------------------------------ 1178
            .....:..:..|..|:|                                                
 Frog   358 TMSRTLQTIQTVQSWLSGGSIQNIEAKLPDHVMQWAHTTLREAVRHNLEGPKMHFNTYVENYSWL 422

  Fly  1179 -----LFKLDLINRVKNSLKELQDFVDE--------ANIVLK-----IELQKDDF-EGLV-KILS 1223
                 ..::|:....::|..:...||::        .|:.::     ::|..||. :||. |..|
 Frog   423 VDGTASQQVDMFLAEEHSFDDYTTFVEQFLQLAKDITNLPVRAHFTMVQLDCDDLKQGLADKAKS 487

  Fly  1224 VLN-----------QINEKQC------------IYDSMFDPLKEIIDLLRQYNYEFKDTELAQIN 1265
            ..|           |.|:..|            :.::..|.::||     .|..:.|..:||::|
 Frog   488 FANILLERLVTDHRQENQMICTEFETIKARALKVPETTEDVIEEI-----AYVEQAKTKDLAELN 547

  Fly  1266 E-----------LPDAWM---KVKRLAATT---KQLIAPIQSYQVDLIEKRILLCDNMANTYRKK 1313
            .           |.|.::   :...|.||.   .|.|.|:.....:||||.....::.....|:|
 Frog   548 ARIAECKRRMNYLLDVYLFPPEDLTLNATVLLWPQNINPVFDANDELIEKAKRKGESELLAKREK 612

  Fly  1314 F------LSKKF-FFVPCLSCYELIDE--SDLELV-----ALEERQRSLAESAVLFELQGPDPV- 1363
            .      ||::. .|..| |..|::.:  ||:..|     ..||....:.:..||::.   ||. 
 Frog   613 LLLELEKLSRRVEEFAEC-SELEMMQQYVSDVRTVQKRITETEEVMAFINKEEVLYKW---DPTV 673

  Fly  1364 --KIELCRFDLKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTW 1426
              :::..:..:::.:..:......|.|...|....:..::.|.||.|..:..||:..:.|..:..
 Frog   674 YPELDSLKASIEMYQKFFGLIYKWQRTEKRWMDGAFLDLNGETMDAELDEIFREVYKMMKFFQQK 738

  Fly  1427 EPFIFME---ASLKNLMTS-----------------------------LRAVTELQNPAIRDRHW 1459
            :.....|   :|.:.::|.                             |..|:.|.||.||.|||
 Frog   739 QQKAEQEKKKSSQRRMLTDEKEEEEKKENPTALMCSTVMEQVKAFKEYLPLVSILCNPGIRTRHW 803

  Fly  1460 IELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGT 1524
            .::....:...:.|..:||:.::..||..|.||.:.|...:.||.::||.:..:...|.|:.|.|
 Frog   804 HQMSDIVQYDLTPDSGSTLRKVLKQNLTPYLEEFEQISVAASKEFSLEKAMHTMVELWDTISFST 868

  Fly  1525 DIHDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQ 1589
            ..:..:.:.:|.|.:|:..||:|...:.|.|..|.:|..||.|::.|:.||....:.|..|.:||
 Frog   869 SPYRESGVSILSAVDEIQTTLDDQIVKTQTMRGSTFIKPFEKEIKQWEERLMRIQETIDEWLKVQ 933

  Fly  1590 RKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSGSKLYEHLE-- 1652
            .:|.|||.|| .||||..|:||:.|.|..:|:.:|.::.....:..|:.:|:..|  |.|.|:  
 Frog   934 AQWLYLEPIF-SSEDIMQQMPEEGRLFQTVDRNWKEIMKHCVKEAKVLNATSLPG--LLEKLQDS 995

  Fly  1653 -ILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSMGKLNL 1716
             :||:.::   |.||.|||.|||.:|||:|:|:.::|:|||...:|..|..||.|.::.:.||..
 Frog   996 NMLLEKIM---KGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEF 1057

  Fly  1717 ISGSKNAAGMVAKELE--EYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHKPRH 1779
            :. :.:...|.:.|.|  |.:..:...:..|.||.||.::.|.|..::||.:.||...|....|.
 Frog  1058 LP-NLDIRAMYSTEGEHVELIETISTSEARGAVEKWLVQVEDVMLRSVRDVIARSRLAYPETLRK 1121

  Fly  1780 VWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAER 1844
            .|:.:||.|..|..:|:.||:|.::|.....|    .|::|..|...|||:::.|:.|.|:...|
 Frog  1122 DWVRDWPGQVVLCVSQMFWTSEVSEAIRDGPQ----GLRNYYDKLQLQLNDIVELVRGTLSKQTR 1182

  Fly  1845 QKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLG 1909
            ..:..:.|||||:||||..::...|..:|.|||.:|||:.|:.  ::....|.:...:|.|||||
 Frog  1183 ITLGALVTIDVHARDVVMDMVETGVSHETDFQWLAQLRYYWEN--ENARVRIINCNVKYAYEYLG 1245

  Fly  1910 NTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYK 1974
            |:|||||||||||||.||..:.:|.:||||.||||||||||||||.:||.:...|||||:.:||.
 Frog  1246 NSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYL 1310

  Fly  1975 SIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGV 2039
            ::....||||.:|||.||||||||.:|||||||.|:.|||.||::|...|:|.|..:.|.....|
 Frog  1311 AMSKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQTKMDLFNFEGTELKLNPNCFV 1375

  Fly  2040 FITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKEL 2104
            .||||||||||:|||:|||.|:|..||:||::|||:||.|.:.||..|:.|:.|.:..|.||.|.
 Frog  1376 AITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQ 1440

  Fly  2105 LSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLF 2169
            ||.|.|||:|:||:|:|||.||.|:.......||.:|:|:::|.|.||.::.|:|:|.|:..|||
 Frog  1441 LSSQFHYDYGMRAVKAVLVAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLF 1505

  Fly  2170 PALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKT 2234
            |...:|.....:.............:||...|:.|::|..|:..|||...::|...:||::|...
 Frog  1506 PGTALPEADYQKLLECAHECCRRHNVQPVPVFLEKMIQTYEMMIVRHGFMLVGEPFSGKTKVLHI 1570

  Fly  2235 LNKT------YQNQKRKPHYNDLNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPK 2293
            |..|      .|..:.|..:..:|||::|..:|||..:|.:.||.||..:...|:.|.......|
 Frog  1571 LADTLSLMNEQQCDEEKVIFRTVNPKSITMGQLFGQFDPVSHEWTDGNVANTFREFALSESPERK 1635

  Fly  2294 WIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYI 2358
            |:|.||.||.:||||:|||:||||.|.|.|.|.|.::.:|.|:||...|..|:||||||.|::|:
 Frog  1636 WVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSPQMSLIFETMDLSQASPATVSRCGMIYL 1700

  Fly  2359 NPQDLGWTPFIQSWLGTRTNS----SEVSMLNVLFDKYVPPLLDIFRTRLRSITPISDIARLQMT 2419
            .|..|||.|.::|||.|...:    ..:.:|..|||..:.|.|...|.:.:.:...|:...:...
 Frog  1701 EPLQLGWNPLVKSWLNTLPEALQAKEHLGLLEQLFDWLIQPALRFLRKQCKELVATSNSNAVVSL 1765

  Fly  2420 CYLLDSML--------TPQNVPNDCPKDWYEIYFVFCIVWGFGSSLFQDQIIDWSNEFSKWFLNE 2476
            ..|.:.:|        |.:|:     :.|....|.|.:||..|.....|..:.:..     ||.|
 Frog  1766 TRLFEMLLFDCIREEPTNKNI-----RTWIMACFAFSMVWSIGGCCDTDSRLKFDA-----FLKE 1820

  Fly  2477 Y---KAVKFPL-------------SGTIFSFYIDHETK---KFFPWTNLVPQFEL-DMDLPLQSN 2521
            .   |:.:.|:             .|.::.:.  :|.|   ::..|...:....| |....:|..
 Frog  1821 ILMGKSAEHPIPAAVGKWECAFDDKGLVYDYV--YELKGRGRWVHWNEFIKSTSLGDKQTKIQDI 1883

  Fly  2522 LVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKL-SALPSDKYSVTNVPFNFYTTSE 2585
            :|.|.:|.|..|.||..|..:.||:.:||:|:||::.:..|| ::|..:|:....:.|:..|::.
 Frog  1884 IVPTMDTVRYTFLMDMCIRYEKPLLFVGPTGTGKSVYVKDKLMNSLDKEKFFPFFINFSARTSAN 1948

  Fly  2586 MLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQKM 2650
            .:|.|:...|:|:....|||...|:.:.||||||||.::||....|..|:|||.|:.:|||    
 Frog  1949 QIQNIIMDRLDKRRKGVYGPPMGKKCVIFVDDMNMPALEKYGAQPPIELLRQFFDHGNWYD---- 2009

  Fly  2651 TLRDIHKCNIV------ACMNPSAGSFTIDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNP 2709
             |:|..|.::|      |...|..|...:.||..|||....:|..|.:.:..|.::|::.::.| 
 Frog  2010 -LKDTSKISLVDIQLLGAMGPPGGGRNAVTPRFLRHFNVCTINAFSDETMVRIFSAIVAFYLRN- 2072

  Fly  2710 IQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSN 2774
             .:|......:...:|...:.::.|.:.:.|||..|.||.|||||.:.:..|.|....|:..|..
 Frog  2073 -NEFPPDFFTVGNQIVNGTMEVYKKAMENLLPTPAKSHYTFNLRDFSRVIQGCLLVQKESVENKR 2136

  Fly  2775 QMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIV----RKGIEGVNDDVVY-AQPLIYCHFAKG 2834
            .::||::||..||:.|:|||..|.:...|::.|:|    ::..:||.:.:.. :|||....|...
 Frog  2137 VLVRLFVHEVLRVFYDRLVDDKDRSWLFKLIKDVVKDHFKENFDGVFEHLKQGSQPLSEEDFRSL 2201

  Fly  2835 L------TDIK-----YMPISGWDRLKSLLDEAQDRYND-YIGAMNLVLFDDAMSHVCRISRILE 2887
            |      .|::     |..|........:::...|.||. :...||||:|...:.|:.||.|||:
 Frog  2202 LFGDYLNPDLEGDERLYAEIPSVQEFNEIVERCLDEYNQTHKSRMNLVIFRYVLEHLSRICRILK 2266

  Fly  2888 SSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCF 2952
            ...|.|||:||||||:||:||||:.::.:.:||.:::|.|.:::.:.::.:|...||||.....|
 Frog  2267 QPGGNALLVGVGGSGRQSMTRLATAMAKMFIFQPEISKSYGMNEWREDLKSLLKNAGVKGQKTVF 2331

  Fly  2953 LMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVR------NEVKQLGIVDNRENCWK 3011
            |:||:::.:|.||..|:.||.:|::..||..||.:.|:..||      |:..:||.:    ..:.
 Frog  2332 LITDTQIKQEAFLEDVDSLLNTGEVPNLFAPDEKQEIMEGVRPAAQAGNKNVELGPL----ALFA 2392

  Fly  3012 YFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLS--EITV 3074
            :|:.:.:..|.:|:.|||:|...|.|.|:||:|:||.|||||..||:.|||.|:::||.  |::.
 Frog  2393 FFVNRCKENLHIVVAFSPIGEAFRNRLRQFPSLINCCTIDWFQPWPEDALERVAVKFLETLELSE 2457

  Fly  3075 LPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRL 3139
            ..:...:|:..:.   |.:...:|..:|.:..|:||.||.|:|||||.:.:||.:|....:..:.
 Frog  2458 HEQREVVPICKYF---HTSAISLSDKFLRDLGRHNYVTPTSYLELIAAFRQLLSQKRDTVMKAKK 2519

  Fly  3140 RLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENEK----VSKERAFASKE 3200
            |..|||.|||....:|..    :|.:.|||:.|.:||.       .||..    :.||.|....:
 Frog  2520 RYTNGLDKLAFAESQVGE----MKKELVELQPKLEEAK-------VENANMMKIIEKESAEVEAK 2573

  Fly  3201 EKNVRQIEEDVTAKA-------KLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVV 3258
            .|.||..||..|.||       ..||.|..:|.|||.||..||:||..:::|.:||..:||..|.
 Frog  2574 SKIVRVDEEIATQKATEAQALKNECESDLAEAIPALEAALSALDTLKPSDVTIVKSMKNPPSGVK 2638

  Fly  3259 SVCGAVLVLFSSKGKIPKDRS---------WKACRAFMGNVDKFLDNLINYDKKHIHPDVIKALQ 3314
            .|..||.|:...|.:...|.:         |...:..:|::: ||.:|..|||.:|...|::.::
 Frog  2639 LVMSAVCVMKEIKPEKINDPAGTGQKILDYWGPSKKLLGDMN-FLRDLREYDKDNIPVAVMQKIR 2702

  Fly  3315 -PYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTAL 3378
             .||.:.:|.|.|:...||||.|||.|::.:..:..|..||.||:..|.|:::.:.:....|...
 Frog  2703 SEYITNPDFDPAKVAKASSAAEGLCKWILAMEVYDRVAKVVAPKKARLAEAQESLANTMALLNTK 2767

  Fly  3379 NLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTF 3443
            ...|.|:|::|.||:..:.|...:|.:.:.:....|..::.|.:|||||..||.||..:...|..
 Frog  2768 RAELKEVEDRLAALEATFREKTEEKARLEVQVDLCAKKLERAEKLIGGLGGEKSRWSSAADSLQN 2832

  Fly  3444 GIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMICDDAQIA 3508
            ....|.||:|:.:..|:|:|.||..:|||. .:.|....|:..  ||.:|.....:.:.|..||.
 Frog  2833 TYDNLTGDVLVSAGVIAYLGAFTAGFRQEC-TRAWSKMCKSKM--IPCSDDFSLSKTLGDPIQIR 2894

  Fly  3509 EWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVK-TKYGTGLVVLRLSQRNYLDQVER 3572
            .||..|||:|..|.:|..|:..|.|:|||||||.|..||:| ::....|.|::|:..:|:..:|.
 Frog  2895 SWNIAGLPTDNFSIDNGVIVSNSRRWPLMIDPQSQANKWIKNSERENQLSVIKLTDSDYMRTLEN 2959

  Fly  3573 AVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTV--LKIGDREIDFNSRFRLILHTKLANPHYK 3635
            .:..|:.||:||:||::||.|.|||.:|..|:|.|  :::|:..|:::|.||..:.|||.||||.
 Frog  2960 CIQFGTPLLLENVGEDLDPSLEPLLLKQTFKQGGVECIRLGETTIEYSSDFRFYITTKLRNPHYL 3024

  Fly  3636 PEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLS 3700
            ||:..:.:|:||.:|.:|||||||..||..|||:||..|..|..|....|..||.:||.:|..|.
 Frog  3025 PELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDKILETLQ 3089

  Fly  3701 SAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLF 3765
            |:..|:|||.:.:..|:..|..::||..|...|:.|.::|..:||.|||.|:.:|:::|.:.||.
 Frog  3090 SSEGNILEDESAIQILDSAKVMSNEITKKQQNAEKTEIKIAESREGYRPIAKHSSVLFFSIADLA 3154

  Fly  3766 KINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTSRGLFEQDKLIFLTQL 3830
            .|:|:||:||..|..::.|::.::..::.|:.|:..|.|..|:..:....|.|||:|||:|...|
 Frog  3155 NIDPMYQYSLNWFVNLYINSIQESNKSKILEKRLRYLNDHFTYNLYCNVCRSLFEKDKLLFSFLL 3219

  Fly  3831 CIQILVNLGEVEPTELDFLLRFPY-----MPNQTSNFTWLTHVGWGGIRALNNQAVFKGLEKDIE 3890
            |..:|:...|:|..|..|||....     :||...  :||....|..|...::...||||.:...
 Frog  3220 CCNLLMAKKEIETPEFMFLLTGGIGLQNNVPNPAP--SWLPEKSWDEICRASDLPAFKGLREHFI 3282

  Fly  3891 GSHKRWKKFVDSESPENEKFPGEWKGK-SAIQRLCIMRCIRPDRMSYAMRSFIEEKLGSKYIDAR 3954
            |....|....||:.|....||..:..: :.:|::.::||:|||::|.|:.:::.||||.|:::..
 Frog  3283 GQANEWHAIYDSKEPHAAPFPSPFNNQLNELQKMIVLRCLRPDKISPAITNYVTEKLGKKFVEPP 3347

  Fly  3955 SMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLG--KSLGFSFDHENFHSVSLGQGQEIVAENA 4017
            ..:.|:::.:||....:.||||||.||:..:.|..  |::|    .:.|.::||||||..||...
 Frog  3348 PFDLSKSYMDSSTTIPLIFVLSPGADPMASLLKFANDKAMG----GDKFQAISLGQGQGPVATKM 3408

  Fly  4018 IEIASQYGHWVILQNIHLVARWLPSLEKKMES-SLSNVHTSYRLFLSAEPAGDPAAHILPQGILE 4081
            |:.|...|.||.|||.||...|:|:|||..|. |....|..:||:|::.|:..     .|..||:
 Frog  3409 IKEALVEGTWVCLQNCHLAVSWMPTLEKICEEFSADTCHPDFRLWLTSYPSPK-----FPVTILQ 3468

  Fly  4082 SAIKITNEPPTGMMANIHKA--LDNFSDETLEM-C-SKETEFKAILFSLCYFHAVVAERRKFGPQ 4142
            :.:|:|||||||:..|:.::  .|..||....: | .||..::.:|:.:|:|||:|.||:||||.
 Frog  3469 NGVKMTNEPPTGLRLNLLQSYLTDPISDPGFFIGCPGKEQIWEKLLYGVCFFHALVQERKKFGPL 3533

  Fly  4143 GWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFM 4207
            |||..|.||..||.||:..|..::.....||:|.:.||.||..|||.:||||||||..|.|.:|.
 Frog  3534 GWNIPYGFNESDLRISIRQLQLFINDYETVPFEAISYLTGECNYGGRVTDDWDRRLLLTTLADFY 3598

  Fly  4208 QPELIDGELEYCQGFPAPG---ILKYTGYHNYID--DNLP-SESPSLYGLHSNAEIGFLTTVSER 4266
            ..::|: :..|  .|...|   :...:.|.:||:  ..|| |:.|.::|||.|.:|......::.
 Frog  3599 NNDIIE-KPRY--SFSPSGNYQVPPKSSYEDYIEFIKRLPFSQHPEVFGLHENVDISKDLQQTKT 3660

  Fly  4267 LFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILELMG----RVEDRSPYIIV 4327
            :|..:...|   .||..||.|.:.:..:..|..|||.|.|..|:|...:.    |.|:....::|
 Frog  3661 IFESLLLTQ---GGGRQGGATGASDHTLYEIANDILSKLPKDFDIEAALQKYPVRYEESMNTVLV 3722

  Fly  4328 AFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQS 4392
              ||.||.|||...::.:|..|...:||.:.:.|.:|.|...|.:.:|||.|.|.:|||:..|.|
 Frog  3723 --QEMERFNNLTRTIRTTLQNLQKAIKGLVVMDSELEALSGSLIVGKVPETWAKRSYPSLKPLGS 3785

  Fly  4393 WFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKNEWPLDRMCLNCDVTKKW 4457
            :.||.:.||:.|:.|. :...|:..||:|||..|:.||..||..|||...|:|.:.....|.  |
 Frog  3786 YVSDFLARLKFLQNWF-ECGKPNVFWLSGFFFTQAFLTGAMQNYARKYRIPIDLIGYEFQVL--W 3847

  Fly  4458 KEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYIKAVTQDKQDIK--NVYE 4520
            .:...:.|.:|.||||||::|||||.:.|.:.:...|.||.|:||::||  ...:.|||  ..|.
 Frog  3848 SDSADSPPEDGVYINGLFLDGARWDRQRGVLGEQLPKLLFDAVPVIWIK--PNKRSDIKKSKSYL 3910

  Fly  4521 CPVYKIRLRGPT---------FVWTFNLKSRERASKWTLAGVCLLLQ 4558
            ||:||...|..|         ||....|.:.:....|...||.||.|
 Frog  3911 CPLYKTSERKGTLSTTGHSTNFVIGMLLPTDKPVQHWIKRGVALLCQ 3957

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571
DHC_N2 1368..1770 CDD:285579 125/439 (28%)
P-loop_NTPase 1903..2132 CDD:304359 137/229 (60%)
P-loop_NTPase 2217..2352 CDD:304359 56/141 (40%)
P-loop_NTPase 2510..2783 CDD:304359 89/281 (32%)
P-loop_NTPase 2860..3127 CDD:304359 104/276 (38%)
MT 3140..3480 CDD:289543 117/361 (32%)
AAA_9 3509..3722 CDD:289547 93/216 (43%)
Dynein_heavy 3864..4549 CDD:281078 254/714 (36%)
dnah12XP_004914230.1 DHC_N2 680..1111 CDD:285579 124/438 (28%)
P-loop_NTPase 1239..1469 CDD:304359 137/230 (60%)
P-loop_NTPase 1553..1695 CDD:304359 57/142 (40%)
P-loop_NTPase 1875..2145 CDD:304359 88/277 (32%)
P-loop_NTPase 2238..2507 CDD:304359 104/276 (38%)
MT 2519..2866 CDD:289543 116/360 (32%)
AAA_9 2896..3110 CDD:289547 93/214 (43%)
Dynein_heavy 3251..3948 CDD:281078 255/721 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.