DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and dnah2

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_017945611.1 Gene:dnah2 XenbaseID:XB-GENE-5967455 Length:4467 Species:Xenopus tropicalis

Alignment Length:4739 Identity:1460/4740 (31%)
Similarity:2388/4740 (50%) Gaps:499/4740 (11%)


  Fly     2 ADEKEKKEP---------VDNRPEFFWNYLTKTMRLKLDKWTKMITTNEFRDVIIEFLNNPNKKR 57
            |.|.|.||.         :|.:|......:..  :|::|.||:     |...|:..|.::.::..
 Frog    41 AAEPEGKESTLPLAIEEYLDLKPNLKQRLVLS--QLRVDAWTE-----ELDAVLDRFASDVSQST 98

  Fly    58 IIFTINSGGQLYPSYSFPVRPRYKVAYFIR----YLTPLHLTDENMLNSLLIGDLLPNPLANLSI 118
            :....:....|....:.|.:...::.||||    .|||     :|:..:|..|.:....:..|..
 Frog    99 LSVYFDPHMGLRVEANMPAQNVEQLMYFIRKEGATLTP-----DNLEETLQFGSVRGTAIVALLR 158

  Fly   119 LCDEVFFPLLNNTVNQVGWTNVIANDMKTESQEMRNGIAQMKGLVINRTIFPLPICMDEVMQAAP 183
            |.:.::.|.:   .:...|...|.|:...........:...:..:..:|:..:||   |.:....
 Frog   159 LMNGLYAPYI---FSNATWPESIRNNFSAHVHRFLAALTDARYKLQGQTVLYIPI---EALHLDV 217

  Fly   184 AIAMGDISVVNPLMKHSLEFMVVKWLDSVEDLVNIKAGEKIYSKENFPLPEAIFSFWESRLENLE 248
            .:|:.|..:|     ..||..:|.|...::::::.:...:| .:.:.||.|  ..||..|..:|.
 Frog   218 EVAVKDKELV-----QRLETAMVHWTRQIKEVLSAQEAVEI-GESSGPLEE--IDFWRDRCADLT 274

  Fly   249 NLAEQLGDRRIKTIGFVLEKIQSIFEHSYRRIVELVLESLAEARDITKCLSPLKRKMDKFETNDM 313
            .:::||....::.|..:||..:|.:...:.::.:.:.|...:|:.....||.||...::..:..:
 Frog   275 GISKQLDQPGVRHIKMILEMAKSSYVGPFHKLSKQIQEGTIQAQSNLSFLSVLKAPFEELTSLSL 339

  Fly   314 DENRSDIRPLMLTIGLVWGHSRYFHTLNNMTLFFNLFHNSLIDCVNRTVEPDSIFQGDVDEAYKK 378
            .:....:..|:..:.::|.:|.:::|...:|..|....|.||...:..|..|.||.|.|..:.:.
 Frog   340 KDIPPKLPRLLSLVRVIWVNSPFYNTRERLTSLFRKISNELIHLCSHQVSLDHIFDGYVTSSRQV 404

  Fly   379 L-DINMQHLEYYKLIYNECRNSLKKF-----KIGTTFNSQDWTWHQDEIFGRLDKFLVRLEEL-- 435
            | |..|            |.|:.|:.     .|...|:...|...|..||.::|.|:.|.::|  
 Frog   405 LKDCIM------------CCNAWKEHYLTAASIHHRFSKTGWVLDQTSIFAQVDAFIQRCKDLLE 457

  Fly   436 ----KDLFNTVRDFQKLEKIVMGGLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLF 496
                ::.|...:|.::.:.....|.:|..:|.:|.:|.|.::...::...::...:  |.:|:.:
 Frog   458 VCLCQEQFARWQDGKQSQLPCFSGAQGPAVTRSLLEIEETFHKNLQQLKAVKKTIL--DVKNTSW 520

  Fly   497 QRDRLSFKAKTD----VMERMVSFQFE--KGLEDTHDLL-LAGSLLLRPIIKKHVEPLMHVIVDD 554
            ..|...|:|...    :|:.:::..||  :|:|:..:|| :...|..|..||:..:.....:...
 Frog   521 HDDYNRFRAGVKDLEVMMQNLINTAFETVRGVEEGVELLDVFHHLSAREAIKRTFDKKTVQVYQL 585

  Fly   555 FEEEIMCVKKEFINFKNVFTALG--LNELPTDDCFPKVSGAISFLKKLRHRI------------- 604
            |::|:..|.||          ||  |..||...|  :.:|....::.||.||             
 Frog   586 FKDELDLVNKE----------LGKKLPTLPPHMC--RFAGQGHAIRGLRRRIDRSMQSLASAHFI 638

  Fly   605 --IGLHKEHELYEYPLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWTVECWQGIQQ------DI 661
              ||:.:| .|.||               ..:.|::|:..:.|..:|:    ||..:      |.
 Frog   639 PRIGIGEE-ALQEY---------------QQLAQKLDELMRKLFSEWS----QGADKQAVRRLDT 683

  Fly   662 TLTLIEKDEANELRVNFTERLIFALKDIKVVRLLGCDVSVNLTKFFCREDELWQARVKLMRIAEW 726
            .|.....::...|.|||.:.::....:|.....|..::...:.:.:.|.:||...|..::.:...
 Frog   684 PLMARSTEKVGMLDVNFDKSVLKMFVEIHYWERLQFEIPHYVAEIYQRREELRNLRENVLLVVRA 748

  Fly   727 YNDTFERAHPTEKRLIAAEMILIEEQMKPLLDFIKWNA--FSQRFI---VMIFKMVKYLHDRLVA 786
            ||.........|:.|....:..::::::|.|..:.|::  .|..||   ::....|:.:.|....
 Frog   749 YNRIIAALSQEERGLFRERIRFLDKKIQPGLTKLHWSSKGASSAFISDCLLHASRVQQIVDNYKL 813

  Fly   787 AQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRAANAADTQRLIDLLMYVNLKL 851
            |.|.:....:.|              :.:||||.|.:                          ::
 Frog   814 ANEKISQCAQKI--------------SESLLLHIDGK--------------------------RV 838

  Fly   852 FFDIPRRYSLPPGEHGEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDDLEEFEEEQSESEE 916
            |.|                                               ::.:|.:||...:.|
 Frog   839 FRD-----------------------------------------------NEFQEVQEEHRSAAE 856

  Fly   917 EIITPFHR---------YELLKGLSQEERALFREYEIYVDEIIAENLVDSVITSSTYLRMEV--D 970
            ..:...|.         ||:.|....|.:..:..|...:|.::.|....:|..|...|...:  |
 Frog   857 TRLHSLHEDICGVMRATYEVFKADGPEVQQHWMIYTDKMDRMVEEAFRLNVKRSLQELSKAINGD 921

  Fly   971 NRYENNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFF--------------IETILDDMNNMMS 1021
            |:...| |:|.:.:.||.         |....||...|              ...||:.::|...
 Frog   922 NKTTAN-PLFRVMVILQS---------DVPGATGQVEFSPSLQQLSHIMSNTCSEILNTISNFRR 976

  Fly  1022 L-----LKRVAQDPTEVTNMNPYSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSS 1081
            |     .|:..::|..|.          ::...|:.|...:|...:.:....::.:.|.:..|..
 Frog   977 LPDVLAKKKFQREPIHVV----------VERDEEIKKILAQINGGVSVNAGLLQAYLKTWDSFRM 1031

  Fly  1082 LWIWDKSTYLSEVKKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIR 1146
            :|..:|..::...:...                           |.:|.:...:.::.|:.:.::
 Frog  1032 IWELNKDAFIRRYQHLN---------------------------PIVSAFDADIARYTEVANNVQ 1069

  Fly  1147 TWETYEDFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFV-DEANIVLKIEL 1210
            ..||.: ...|:.|:.:..|.|::....:|.:.|...|.:.....|.||..:: |.|:.||:   
 Frog  1070 KQETVQ-HIQFVLLDCSHLKFALVQHCNEWQNKFTGLLSHMASAKLMELHGYLRDNADRVLQ--- 1130

  Fly  1211 QKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKDTELAQINELPDAWMKVK 1275
            .....|.|.:.|.:...:..:.....|...|:.|...:|.:|.....:..|..:..|..||:..:
 Frog  1131 PPQTLEELAQSLQLYETLQSELAKVQSQIPPIHEQFAILEKYEVVVDEAVLQTLASLNGAWISFQ 1195

  Fly  1276 R-LAATTKQLIAPIQSYQVDLIEKRILLCDNMANTYRKK--FLSKKFF----FVPCLSCYELIDE 1333
            : |..:...|....:.::..||        :.|..::||  .|.::|.    |:..|.|...:::
 Frog  1196 QSLIDSESMLKKSKEKFKTSLI--------HTAEEFKKKTHSLLEEFTAKGPFLSSLGCEPALEQ 1252

  Fly  1334 SD-----LELVALEERQRSLAESAVLFELQGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDWK 1393
            ..     :|.:..||....|..|  :|:::.|....:.....||..::::|:.....:....:||
 Frog  1253 ISMTREMMETLKAEENTIHLGLS--MFKIEQPSSKDLRALEKDLDSLQLVWEATQEWEQRWEEWK 1315

  Fly  1394 KTPWKKIDIENMDQECKKFGRELRGLDKAM--RTWEPFIFMEASLKNLMTSLRAVTELQNPAIRD 1456
            ...:..:..:.|:...:...|.|..|.:.:  :.||........:.....::..:.:|:|||:|:
 Frog  1316 SGSFLTLQTDLMESTAQGLYRRLSKLSRELKEKNWEIVETSRQRIDQFKRTMPLIADLRNPALRE 1380

  Fly  1457 RHWIELMQTTKVKFSMDDST----TLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAW 1517
            |||.::.|..:..|   |.|    ||:.:::|.|.::.|::..|...:.||:.:|:.|.:|:..|
 Frog  1381 RHWSQVKQEVQGPF---DETAEDFTLEKIVELGLDQHVEKISEISTSATKELFIEQGLENISKTW 1442

  Fly  1518 -----GTMEFGTDIHDRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSN 1577
                 ..|.:....|.|     |:.::::.:.|||:|..|..|.:|.::..||.:|..|:..||:
 Frog  1443 EATLLDIMPYKDKGHHR-----LRGTDDVFQALEDNQVALSTMKASPFVKAFEQDVDRWERCLSH 1502

  Fly  1578 ADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNR 1642
            ..::|.....|||:|.|||:||.| ||||.|||::|..||.|:..:|.::.::..|.|.:|.|:.
 Frog  1503 ILEVIEMILTVQRQWLYLENIFTG-EDIRKQLPQESAEFDDINVSWKVIMGRLTKDNNALRGTHH 1566

  Fly  1643 SGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKL 1707
            .|  |.|.|..:..:|...:|:|:.||||||..:|||||:|:.|||:||....||..|..||.|.
 Frog  1567 PG--LLEKLGEMNGVLEGIQKSLDMYLETKRHIFPRFYFISNDDLLEILGQSRNPDAVQPHLKKC 1629

  Fly  1708 YDSMGKLNLIS---GSK-NAAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKR 1768
            :|::..|.:..   ||| .||||.:.| .|||.|.......|.||.||..|...||.||::.|:.
 Frog  1630 FDNIKSLKIQKAGIGSKYEAAGMFSAE-GEYVDFTHPVLLEGPVEAWLCDIERTMRWTLKELLRN 1693

  Fly  1769 ---SLTFYDHKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYE-NALKDYNKKQITQLN 1829
               :|.....| |..|:.||..|..:..:||.||.:...:....::|.| ..||...|||::.||
 Frog  1694 CRLALKKMSSK-RDKWVKEWAGQMLITSSQIQWTADVTKSLMAAKERGEKKILKIMKKKQVSMLN 1757

  Fly  1830 NLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFA 1894
            .....:.|:||...|.|::.:.|::||:|||:..::........:|:|.||||..||..:|||..
 Frog  1758 KYSDAIRGNLTKNLRLKLVALVTVEVHARDVIDKMLKSGCMDVASFEWLSQLRLYWDKDVDDCLI 1822

  Fly  1895 NICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALG 1959
            ...:.||:|.||||||:.||||||||||||:|||.:|||..||:|.||||||||||.||||:|||
 Frog  1823 RQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALG 1887

  Fly  1960 MMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTF 2024
            |.|.|.||||.:||||:|.::.|||||||||||||||||::|||||||.|:..|..|:.:....|
 Frog  1888 MYVIVVNCSEGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILTALSANLTRF 1952

  Fly  2025 SFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARL 2089
            .|.|..|.|..:.|:|||||||||||.|||:|||:::||.:|||||..||:||:|..|||...::
 Frog  1953 VFEGREINLVWSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEIILFGEGFNNCKV 2017

  Fly  2090 LARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLMRALRDFNIPKIV 2154
            ||:|..|||:|..:.||||||||:||||:.|:|..:|..||......:::||:.|::|.|:.|:.
 Frog  2018 LAKKVYTLYSLAVQQLSKQDHYDFGLRALTSLLRYSGRKRRLQPNLSDEEVLIMAMKDMNVAKLT 2082

  Fly  2155 TDDVPVFMGLIGDLFPALDVPR----KRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVR 2215
            :.|:|:|.|::.||||.::.|.    |...:.|..:|.|.    ||.....:.|::||.|....|
 Frog  2083 SVDLPLFSGIMQDLFPGIETPTVDYGKLREQIEQELKLSG----LQVTPFTVSKVIQLYETKTSR 2143

  Fly  2216 HSVFIIGFAGTGKSEVWKTLNKTYQ--NQKRKPHYND-----LNPKAVTNDELFGIVNPSTREWK 2273
            ||..::|...:||:.:|:.|.....  |:....:||.     |||||::..||:|..:.:|.||.
 Frog  2144 HSTMLVGRTCSGKTTIWRCLQGALSALNKAGDGNYNQVRDFPLNPKALSLGELYGEYDLTTNEWT 2208

  Fly  2274 DGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFE 2338
            ||:.|.|||..........|||:.||.:|.:||||:|:||||||||||.:.||||:.:::.||||
 Frog  2209 DGILSSLMRTACADDRPEEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFE 2273

  Fly  2339 IASLRTATPATVSRAGILYINPQDLGWTPFIQSWL------GTRTNSSEVSMLNVLFDKYVP-PL 2396
            ::.|..|:||||||.|::|.:...|||.|::||||      ......|..|::       || ||
 Frog  2274 VSDLAVASPATVSRCGMVYTDHTSLGWRPYVQSWLEKHPKVSPAAPGSPTSLV-------VPWPL 2331

  Fly  2397 LDIFRTRLRSITPISDIARLQMTCYLLDSMLTPQNV-PNDCPKDWY---EIYFVFCIVWGFGSSL 2457
                       ||:         |:      :|..| |:| |:.:.   |::|:||:||...:|:
 Frog  2332 -----------TPL---------CF------SPGQVNPSD-PESYLRMAELWFLFCLVWSVCASV 2369

  Fly  2458 FQDQIIDWSNEFSKWFLNEYKAVKFPLSGTIFSFYIDHETKKFFPWTNLVPQ-FELDMDLPLQSN 2521
            .::......|     :|.|.:. .||...|::.:|:|.:||.:..:.:.:|: :.:..:.|....
 Frog  2370 DEEGRRKIDN-----YLREMEG-SFPSKDTVYEYYVDPKTKNWVSFEDKLPKGWRIPTNAPFYKI 2428

  Fly  2522 LVNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEM 2586
            :|.|.:|.|.:|.::.|:....|::|:||.|:|||.:..:.|.:|.|.|::|..|..:..||:..
 Frog  2429 VVPTVDTVRYQFIVNALVSHQSPVLLVGPVGTGKTSIAQSVLQSLDSSKWAVLTVNMSAQTTTNN 2493

  Fly  2587 LQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQKMT 2651
            :|.|:|..:||:....|.|.|.||:|.|:||:|||..|.:.:..|..|:|.::||..|||||..:
 Frog  2494 VQDIIESRVEKRTKGVYVPSGGKRLITFLDDLNMPAKDTFGSQPPLELLRLWIDYGFWYDRQNQS 2558

  Fly  2652 LRDIHKCNIVACMNPSAGSFT-IDPRLQRHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDK 2715
            ::.|....|:|.|.|..|..| |..|||..|....:..||:..:..|..:::||    .:|.||:
 Frog  2559 IKYIKDMFIMAAMGPPGGGRTAISSRLQSRFNLINMTFPSESQIRRIFGTMMSQ----KLQDFDE 2619

  Fly  2716 AVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLW 2780
            .|..:.:.:....:.|:..:...||||..|.||.||||||:.:|.|:|.:..:.......:.|||
 Frog  2620 EVKPVGDLITQATVELYNAITQRFLPTPAKIHYLFNLRDISKVFQGMLRAQRDLHDTKQSITRLW 2684

  Fly  2781 IHECYRVYGDKLVDYTDINSFKKIVSDIVRKGIEGVNDDVVY------AQPLIYCHFAKGLTDIK 2839
            :|||:||:.|:|||.:|.::|..|:|:.:     |...::.|      .||.::..|.:  ....
 Frog  2685 VHECFRVFSDRLVDSSDADAFVAILSEKL-----GSLFNLTYHNLCPSKQPPVFGDFLR--EPPV 2742

  Fly  2840 YMPISGWDRLKSL----LDEAQDRYNDYIGAMNLVLFDDAMSHVCRISRILESSRGYALLIGVGG 2900
            |..|:.:..||:.    |.|...|..  .||.:||||.||:.||.||.|::...||..||:|:||
 Frog  2743 YEDITDFQALKTFMNRQLQEQSQRPG--AGAKSLVLFTDAIQHVTRIVRVIGQPRGNMLLVGIGG 2805

  Fly  2901 SGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANIATLYMKAGVKTSACCFLMTDSEVAREQFL 2965
            ||:|||.||||:|....|||:::|:.|...:.:.:|..||..|||......||:||:::..|.||
 Frog  2806 SGRQSLARLASYICDYKVFQLEVTRGYRKQEFREDIKRLYRLAGVDDRPSVFLLTDTQITDESFL 2870

  Fly  2966 VLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLGIVDNRENCWKYFIEKVRSLLKVVLCFSPV 3030
            ..||::|:||::..|:..||.|.|.:|:..:.::..|.|..|:.:.:.||:||:.|.:|||.|||
 Frog  2871 EDVNNILSSGEVPNLYKADEFEEIKSALSEKAREQNIPDTPESLFNFLIERVRNNLHIVLCMSPV 2935

  Fly  3031 GATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSLRFLSEITVLPKE-LALPVSNFMAFVHKTV 3094
            |...|.|.|::||||||||||||.||||:||..|:.|:|..:.:...: :...|:.....:|::|
 Frog  2936 GDPFRNRIRQYPALVNCTTIDWFSEWPQEALLEVAERYLEGVQLGAIDGIQGKVARIFVTMHRSV 3000

  Fly  3095 NDISKLYLANAKRYNYTTPKSFLELIALYSKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQ 3159
            .:.|.......:|:||.||.|:||:::.|..||.||.|...|:..:|.|||.|:....::|:.:.
 Frog  3001 AEFSHRMKLELRRHNYITPTSYLEVVSRYKSLLAEKRKELGDKATKLRNGLFKIDETREKVEKMS 3065

  Fly  3160 DVLKVQEVEL-KIKNQEADNLIIVVGTENEKVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFL 3223
            :.|.|...:: :.:.|..:.|:|:|....|...:::..|:..|| :...|....|.|:..::|..
 Frog  3066 EQLAVARSKVAEFQKQCEEYLVIIVQQRREADEQQKTVAAHSEK-IAAEEIKCKALAENAQKDLE 3129

  Fly  3224 KAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSWKACRAFMG 3288
            :|.|||..|..||.:|||.::||:||:|.||..|.:|..||::|   :|..|   :|...:..:|
 Frog  3130 EALPALEEAMRALESLNKKDMTEIKSYGRPPALVETVMQAVMIL---RGNEP---TWAEAKRQLG 3188

  Fly  3289 NVDKFLDNLINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLV 3353
            . ..|:..||::||.:|...|:|.:..|.:..:|.|:.|...|.||..||.||..:..:..::.|
 Frog  3189 E-SNFIKQLIHFDKDNISDRVLKKIGQYCILPDFQPDIIGKVSLAARSLCMWVRAMEVYGRLFRV 3252

  Fly  3354 VEPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTID 3418
            ||||...:..:..::.:.:..|.....:|.|:.|:|..|:.:|||.||:|:..:.||......:.
 Frog  3253 VEPKRARMNAAMNQLAEKQASLAEAQNKLREVAERLEQLKTQYDEKLAQKEALRAEAELMELKLQ 3317

  Fly  3419 IANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQELQEKLWMPAFK 3483
            .|..|:.|||.||.||.|:||.|...:..|.||.|:.|.::||:|.|..:||:.:. .:|:...:
 Frog  3318 RAGTLVTGLAGEKSRWEETVKGLDEDLGFLVGDCLLASAYLSYMGPFLSSYREGIL-SIWIKEVR 3381

  Fly  3484 NSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWV 3548
            ....|..:...:..|  :.....:.|||.||||||..|::|..|:.:..|:|||:|||.|..||:
 Frog  3382 EMLVPCSAVFSLTNF--LSSPTMVREWNLQGLPSDSFSSDNGVIVTRGNRWPLMVDPQGQATKWI 3444

  Fly  3549 KT-KYGTGLVVLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKKGTVLKI-- 3610
            |: :...||.|:.|...:::..:|:||..|..:|::|:.|.:||.|.|:|.:.:.|.|..|:|  
 Frog  3445 KSMESAKGLKVIDLQMTDFMRTLEQAVQFGFPVLLQNVQEELDPSLAPILNKSVTKVGGQLQIRL 3509

  Fly  3611 GDREIDFNSRFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRT 3675
            ||::|.:|..||..:.|||:||||.||:.:|.|::||.|...|||.|||..||:.|||:||..:.
 Frog  3510 GDKDIVYNPEFRFYITTKLSNPHYTPEISSQATIVNFAVKEQGLEAQLLGSVVRKERPELEEQKQ 3574

  Fly  3676 RLTQQQNHFKITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQI 3740
            .|.......|..|:.|||::|..|:.|..::|:||.|:..|:.:|.||.|:..::..::.|..:|
 Frog  3575 SLVLNIAAGKRKLQELEDEILRLLNEATGSLLDDVQLLNTLQTSKVTATEVSEQLESSEETEEKI 3639

  Fly  3741 DSAREAYRPAAERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDS 3805
            |:|||||||.|:|||:::|:||||.:|:|:|||||.::|.:|:.::.|:..:..:::|:.||.|.
 Frog  3640 DTAREAYRPCAQRASLLFFVLNDLGRIDPMYQFSLDSYTDLFHLSIDKSKRSANVEERIANLNDW 3704

  Fly  3806 ITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLL-------RFPYMPNQTSNFT 3863
            .|:..:.||.|.|||:.||:|..|:|.:||...|::...|.:|.|       |...|.|..|  .
 Frog  3705 HTYAVYRYTCRALFERHKLLFSFQMCAKILEVAGKLNMDEYNFFLRGGVVLDREEQMDNPCS--A 3767

  Fly  3864 WLTHVGWGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKGK-SAIQRLCIMR 3927
            ||:...|..|..|:..|.|.|:....|...:.|.::..|..||:...||||:.. |.|||:.|:|
 Frog  3768 WLSDTNWDNITELDKLANFHGIMNSFEQYPRDWHQWYTSPEPESACLPGEWENSCSEIQRMLIVR 3832

  Fly  3928 CIRPDRMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSL 3992
            .:|.||:::.:.|||...||||:.:...::.....|:|.|.:.:.|||||||||...:.:|.:..
 Frog  3833 SLRQDRVAFCVTSFIINNLGSKFTEPPVLDMRAVVEDSLPRSPLVFVLSPGVDPTGALLQLAEQC 3897

  Fly  3993 GFSFDHENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMES-SLSNVHT 4056
            |.:   :|||::||||||..:|...|:...:.||||.|.|.||...|:|.|:|.:|. .:.:.|.
 Frog  3898 GMA---QNFHALSLGQGQAPIATRMIKEGVKDGHWVFLANCHLSLSWMPQLDKLVEQLQIEDPHP 3959

  Fly  4057 SYRLFLSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKA 4121
            ::||:||:.|..|     .|..||:::||:|.|||.|:.||:.:.....:::....|:|.:.::.
 Frog  3960 NFRLWLSSSPHPD-----FPISILQASIKMTTEPPKGLRANMTRLYQLITEQQFSHCAKSSSYRR 4019

  Fly  4122 ILFSLCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMY 4186
            :|||||:||:|:.|||||...|||..|.||..|..:|..:|..||:.....|||.|:||...:.|
 Frog  4020 LLFSLCFFHSVLLERRKFLQLGWNIVYGFNDSDFEVSENLLSLYLDEYEETPWEALKYLIAGVNY 4084

  Fly  4187 GGHITDDWDRRLCRTYLEE-FMQPELIDG--ELEYCQGFPAPGILKYTGYHNYIDDNLPSESPSL 4248
            |||:||||||||..||:.: |.:|.|.:.  .|.....:..|.......|..:|.....::.|..
 Frog  4085 GGHVTDDWDRRLLSTYINDYFSEPALTNQFYRLSSLDTYYIPRDGPLASYKEFISLLPAADHPEA 4149

  Fly  4249 YGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNILE 4313
            :|.|.||:|....|.:..||..:..|||::|..:.||....:|.:: :::.|:.:|.|..   ::
 Frog  4150 FGQHPNADIASQITEARTLFDTLLSLQPQITPSAQGGGQTREEKVL-DLLSDVREKIPPE---ID 4210

  Fly  4314 LMGRVE----DRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQ 4374
            ..|..:    |.:|..:|..||.:|.|.|:..::.|||:|:.|::|.:.:|:.:|::..|:|..:
 Frog  4211 YEGTCKVLSGDPNPLNVVLLQEIQRYNALLDTIRTSLNDLERGIQGLVVMSAELEEIFTCIYDAR 4275

  Fly  4375 VPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARK 4439
            ||..|.| ||||:..|.:|..||:||:.....|......|...||:.|..|...|||::|..||:
 Frog  4276 VPPLWEK-AYPSLKPLAAWTRDLVLRVELFSRWAKTAHPPVLFWLSAFTFPTGFLTAVLQSAARQ 4339

  Fly  4440 NEWPLDRMCLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLY 4504
            |...:|.:.....|:......|...|::|.:|.||::|||.||.|...:.:|...:|...:|.::
 Frog  4340 NNVSVDSLSWEFIVSTVDDNNLVYPPKDGVWIRGLYLEGAGWDKKNSCLIEAEPMQLVCPLPTVH 4404

  Fly  4505 IKAVTQDKQDIKNVYECPVYKIRLRG-----PTFVWTFNLK-SRERASKWTLAGVCLLL 4557
            .:.....|:..|.:|.||.|...:|.     .:||...:|: ....|..|...|..||:
 Frog  4405 FRPTESRKKSSKGLYSCPCYYYPVRAGSSGRASFVIGVDLRCGAAPAEHWIKRGTALLM 4463

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 126/608 (21%)
DHC_N2 1368..1770 CDD:285579 134/420 (32%)
P-loop_NTPase 1903..2132 CDD:304359 146/229 (64%)
P-loop_NTPase 2217..2352 CDD:304359 62/142 (44%)
P-loop_NTPase 2510..2783 CDD:304359 93/274 (34%)
P-loop_NTPase 2860..3127 CDD:304359 112/268 (42%)
MT 3140..3480 CDD:289543 109/341 (32%)
AAA_9 3509..3722 CDD:289547 91/216 (42%)
Dynein_heavy 3864..4549 CDD:281078 237/700 (34%)
dnah2XP_017945611.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492at2759
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.