DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and dnah6

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_021326862.1 Gene:dnah6 ZFINID:ZDB-GENE-030616-623 Length:4163 Species:Danio rerio

Alignment Length:4113 Identity:1273/4114 (31%)
Similarity:2100/4114 (51%) Gaps:460/4114 (11%)


  Fly   699 VSVNLTKFFCREDELWQARVKLMRIAEWYNDTFERAHPTEKRLIAAEMILIEEQMKPLLDFIKWN 763
            ||.:....:|..:      |..:.:..|     |:.:...::|:...:..:         |.||.
Zfish   255 VSTHAVTHYCGSE------VDCLPLERW-----EQEYQFHRKLLRIPVFAL---------FRKWK 299

  Fly   764 AFSQRFIVMIFKMVKYLHDRLVAAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTDPREPILS 828
            ||......:.:|.:......|   ||||..:.||:|              |||:   |.||....
Zfish   300 AFRVWRANVRYKKISKCRRSL---QENLFVLNESLR--------------PALI---DIREMCYH 344

  Fly   829 IRAANAADTQRLIDLLMYVNLKLFFDIP-------RRYSLPPGEHGEEDEESDGIWPPIISLSVM 886
            |.                       |:|       ..::|...:..:..:..:            
Zfish   345 IS-----------------------DMPLCRLEKDHTFTLKEFQRAQYTQLEE------------ 374

  Fly   887 TSVKFKKKREVIDE------EDDLEEF------EEEQSESEEEIITPFHRY------ELLKGLSQ 933
            .|.:.:|.||::.|      .:.|:||      .|.:::..||:.:|..:.      |.:....|
Zfish   375 VSSRLEKFRELVMEVARNACRNALKEFGHTPDYGEVETDGNEELASPAFKLVFEDTPEKITYTQQ 439

  Fly   934 EERA-------------------------------LFREYEIYVDEIIAENLVDS----VITSST 963
            ..::                               |.|.::.::....:..|:.|    .||..|
Zfish   440 ANKSYHCKRLTCFIRLADYLIVNTTHMLVVNSVSKLLRVFQEHITHTPSPALIQSWTGNEITHDT 504

  Fly   964 YLRMEVD-NRYENNTPIF-----------------EIFMELQEPNVVYFR----NLDT-SSKTGF 1005
            .:::..: |....:.|:|                 |.|.|.....:..|.    :||| ...|.|
Zfish   505 DIKVTAEQNISAYHQPMFITELMLDTHSLSYQPSNEDFQECVAEIIGQFEKTVLSLDTLVQDTYF 569

  Fly  1006 AFFIETILDDMNNMMSLLKRVAQDPTEVTNMNPYSFYDELQDKSELDKQRVEIMNKIKLALQAVR 1070
            ..|.:.|::     ..:.:::..|...|..:        |::.:.|....:.|...|:.|.....
Zfish   570 DAFTQPIIN-----QKVEEKICGDGPSVEEI--------LEEDAYLQDIILNIKQSIQTAFVTAN 621

  Fly  1071 VHGKGFMEFSSLWIWDKSTYLSEVKK------FGRNLTLDERDAE-ADLEGSSGVKLLGLEYPPL 1128
            |:.:.|..|...:..::...|..:|:      |..| :||:...| .:.......:.||:.....
Zfish   622 VYARTFEPFRLFYKENEDLDLEALKEQEHEVVFFEN-SLDKYHQEHKEALAIQQKRPLGILLVDT 685

  Fly  1129 SVYKEQLDKFIELQDQIRTWETYEDFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLK 1193
            :..|.:|     :...:|..|...|....|........:|.:..     :.||||.:..|..   
Zfish   686 TELKHRL-----IPSPLRCIEAINDILPRLAKKKMDDIIAEVQD-----AQFKLDFVPTVTT--- 737

  Fly  1194 ELQDFVDEANIVLKIELQKDDFEGLVKILSVLNQINEKQCIYDSMFDPLKEIIDLLRQYNYEFKD 1258
               ::||..|.:       |:.:..:::|       ||:.:      .:.|:..|:..|:.....
Zfish   738 ---EYVDSLNFL-------DEIQKRIEVL-------EKETV------TVSEMYKLIECYSVPTPP 779

  Fly  1259 TELAQINELPDAWMKVKRLAATTKQLIAPIQSYQVDLIEKRILLCDNMA-------NTYRK-KFL 1315
            .::|....||.....|:.   |..:.:....||    ::|   .|.::.       ||.:: |..
Zfish   780 EDIAVYATLPPCITAVRN---TIDKAVGERDSY----VDK---FCQHLQQDIGQLNNTVQEVKAE 834

  Fly  1316 SKKFFFVPCLSCYELID-ESDLELVALEERQRSLAESAV-LFELQG--------PDPVKIELCRF 1370
            ::.         ::|:| ::|...:     :|.|.:..: :.|||.        ....|:|:.::
Zfish   835 AEN---------HQLLDIDADRSHI-----RRLLGDIQISIDELQSQAFKYKTYQKNFKVEVTKY 885

  Fly  1371 D--------LKLVKIMWDFAITIQSTINDWKKTPWKKIDIENMDQECKKFGRELRGLDKAMRTWE 1427
            |        :||.:::||.....:|..|.|.:..:.::|.|.:.::..:|.:.:..|:|.:....
Zfish   886 DTLEELTAEVKLKQLLWDSLEEWESLENGWLQDKFDELDPELLSKQVNRFVKYVSQLEKGLPPNN 950

  Fly  1428 PFIFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEE 1492
            ...|::|.::::...|..:|:|:||.::.||| |:::.......::::.||..|.::::..:..:
Zfish   951 VVPFLKAKVESMREKLPVITDLRNPCLKARHW-EMLEAIVDSKLLEEAQTLATLQNIDIFRFGLQ 1014

  Fly  1493 VKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIH-DRTSIKLLKASEELIETLEDHQGQLQNMA 1556
            ::.:..::..|.::|..||.|..:|.|.||....| |...:.:|..::::...|:|....:..:|
Zfish  1015 IQEVSGQASGEASLENILRKIEDSWKTTEFIVLPHRDTKDVFILGGTDDIQVLLDDSIVNVATVA 1079

  Fly  1557 SSKYIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDK 1621
            ||:|....:..|..||.:|...:|.:..|...||.|.|||||| .:.||:.|||.:::.|..:||
Zfish  1080 SSRYAGPIKARVDKWQRQLLLFNQTLDEWLLCQRSWLYLESIF-SAPDIQRQLPAEAKMFLQVDK 1143

  Fly  1622 EFKALLAQMNADRNVVRSTNRSG-SKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSA 1685
            .:|.::.::|...|.:|:..::| ..::::...||:.:   :|.|..|||:||:.:|||||:|:.
Zfish  1144 SWKEIMRKVNRMPNALRAATQTGILDVFQNNNALLERI---QKCLEAYLESKRVIFPRFYFLSND 1205

  Fly  1686 DLLDILSNGNNPALVARHLTKLYDSMGKLNL----------------ISGSKNAAGMVAKELEEY 1734
            :||:||:...||..|..||.|.:|::.:|..                |..:.:...||:.|.|:.
Zfish  1206 ELLEILAQTRNPQAVQPHLRKCFDAISQLEFATLTPTTPEGDDTVEKIQYTNDILSMVSPEGEKV 1270

  Fly  1735 VPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYDHKPRHVWIFE-WPAQPALVGTQIMW 1798
            | ..:.....|.||.||.::.:.|..:||...|.::..|..|||..|:.. .|:|..|..:|:||
Zfish  1271 V-LGKGLKARGNVEDWLGKVEEAMFSSLRRLSKAAIADYQSKPRVEWVVAGHPSQVVLTISQLMW 1334

  Fly  1799 TTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGT 1863
            ..:.::........:: ||:::......:||.|..|:.|:|.:..|..|..:.|||||:||:|..
Zfish  1335 CRDMDNCLEGEHDHFQ-ALQEFEITNFERLNALAALVRGNLPSLHRNIITALITIDVHARDIVTD 1398

  Fly  1864 IIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLT 1928
            ::.::|:....|:||.|||:.||..:|||.|.:..:|:.|.|||||..|||||||||||||:.|.
Zfish  1399 LVKEQVDSSDNFEWQRQLRYYWDVDLDDCVARMALSQYIYGYEYLGACPRLVITPLTDRCYLCLM 1463

  Fly  1929 QSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFD 1993
            .:|.|.:|||||||||||||||||||.:||.:...|||||:.:|||.:|....||||:|||.|||
Zfish  1464 GALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGTFFSGLAQSGAWCCFD 1528

  Fly  1994 EFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLK 2058
            |||||::|||||:|.|:..|::|..:|...|.|.|..|.|..|...|||||||||||.|||:|||
Zfish  1529 EFNRINIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLK 1593

  Fly  2059 ALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLV 2123
            ||:||.||:||::|||:|::|.:|||:.::.||||...:|.||.|.||:|||||:|:||:|||||
Zfish  1594 ALFRPIAMMVPNYALIAEVILYSEGFESSKTLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLV 1658

  Fly  2124 VAGALRRDDRQRPEDQVLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKR 2188
            :||:|:|::....||.||:|||||.|:||.:.||..:|.|::.||||.:.:|.......::.|..
Zfish  1659 MAGSLKRENPNLSEDVVLIRALRDSNLPKFLKDDAALFSGILSDLFPGVTIPEHDYGVLQSTIHS 1723

  Fly  2189 SALDLKLQPEDGFILKIVQLEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKRKPHYND--- 2250
            |.....|||....|.|::||.|...|||.|.::|..|:||:.|::.|..|........|.|.   
Zfish  1724 SLCQRSLQPLPSIISKVIQLYETMLVRHGVMLVGPTGSGKTTVYRVLADTLDTLHHAGHPNPFFR 1788

  Fly  2251 ------LNPKAVTNDELFGIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESL 2309
                  ||||:|:..||:|.|||.|.||:|||.::.:|..........||::.||.:|.:|||::
Zfish  1789 PVKTYVLNPKSVSMGELYGEVNPLTLEWRDGLMALCVRAAVQDFSDDHKWVISDGPVDALWIENM 1853

  Fly  2310 NTVMDDNKVLTLASNERIALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWL- 2373
            |||:||||:|.||::|||.||..:.::||:..|..|:||||||.|::||:|::|.|.|::|:|| 
Zfish  1854 NTVLDDNKMLCLANSERIKLTPSIYMMFEVQDLAVASPATVSRCGMVYIDPEELKWMPYVQTWLT 1918

  Fly  2374 --GTRTNSSEVSMLNVLFDKYVPPLLDIFRTR--LRSITPISDIARLQMTCYLLDSMLTPQNVP- 2433
              ..:.:......|..||::||...|. |.::  |:::..: ||:::...|.||:::|.....| 
Zfish  1919 GFAEKISDPVRGYLMELFEQYVEKGLQ-FASKHCLQAVAQV-DISKVTTLCCLLEALLFSDGAPS 1981

  Fly  2434 --------ND--CPKDWYEIYFVFCIVWGFGSSLFQDQIIDWS--NEFSKWFLNEYKAVKFPLSG 2486
                    |:  |..      ||||.:|..|.:|.:..   |.  :.|.:....:....|.|..|
Zfish  1982 LKMESSKLNNVLCQT------FVFCYLWAVGGNLIESH---WDTFDTFVRQQFEDNTDAKLPSVG 2037

  Fly  2487 TIFSFYIDHETKKFFPWTNLVPQFELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPS 2551
            .::|.|::.:.|...||..::|.|..:.::|....||.|.:|.|..:.|:.|:..:|.::..|.:
Zfish  2038 DLWSVYMNFDIKCLEPWERIIPVFSYNSEIPFFEMLVPTTDTVRYGYLMEKLLSVNHSVLFTGIT 2102

  Fly  2552 GSGKTILMNAKLSALPSDKYSVTNVPFNF--YTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYF 2614
            |.||:::..|.|::: .:|.....|..||  .|:|...|.|:|..||||.....|...||:::.|
Zfish  2103 GVGKSVVARALLNSV-QEKAGYVPVYINFSAQTSSARTQEIIESKLEKKRKNILGAPANKKIVVF 2166

  Fly  2615 VDDMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIHKCNI-VACMNPSAGSFTIDPRLQ 2678
            |||:|||::|.|.:..|..|:|||.|:|.:|||:|...::||...| .||..|..|...:.||..
Zfish  2167 VDDLNMPKLDSYGSQPPIELLRQFQDFHGFYDREKFFWKEIHDMTIAAACAPPGGGRNPVTPRFI 2231

  Fly  2679 RHFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTA 2743
            |||....:..||:.:|..|..:||...    :.:|..||.:..:::|..|:.::.::....|||.
Zfish  2232 RHFSMLCLPTPSESSLKQIFKAILGGF----LTEFSTAVKQAADSIVDAAVEIYHRMSVDLLPTP 2292

  Fly  2744 IKFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDI 2808
            .|.||.|||||::....|:|.....|..:...:.||:.|||.||:.|:|::..|.:.|..::|::
Zfish  2293 AKSHYVFNLRDLSKCVQGMLQCEPTTVRDQTHIFRLFCHECQRVFHDRLINNEDKSYFNTMISEM 2357

  Fly  2809 VRKGIEGVNDDVVY--AQPLIYCHFAK---GLTDIKYMPISGWDRLKSLLDEAQDRYN-DYIGAM 2867
            ..|.. .:|.:..|  .||:|:..|.|   ...|..|..::..|:::.:|.:..|.|| .:....
Zfish  2358 ASKYF-SINIEPAYFVNQPIIFGDFIKVGADKADRVYEDLTDMDKIRQVLQDYLDDYNTTFAKET 2421

  Fly  2868 NLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDL 2932
            .||.|.||:.||.||:|::...||.|||:||||:|||||||||:.:.....|||:|::.|:....
Zfish  2422 KLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHMCGYRCFQIELSRGYNYDSF 2486

  Fly  2933 KANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEV 2997
            ..::..||..|||:.....||.||:::..|:||..:|::|.||::..||..||::.::.|:..:.
Zfish  2487 HEDLRKLYRMAGVEGQDMVFLFTDTQIVVEEFLEDINNMLNSGEVPNLFEKDELKQVLAAISPKA 2551

  Fly  2998 KQLGIVD-NRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQAL 3061
            |:.||.: ||:..:::||.:||..|.:|||.||||.:.|.|.|.||:||||.|||||.:||::||
Zfish  2552 KEAGISEGNRDEVFQFFISRVREKLHIVLCMSPVGDSFRSRCRMFPSLVNCCTIDWFVQWPREAL 2616

  Fly  3062 ESVSLRFLSEITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKL 3126
            .|||..|...:....:|:....|.....:|.:|.|:::.:.:..:|:.||||.|:||||.||..:
Zfish  2617 LSVSQTFFQNVEFGSEEMKQCFSEMCVEIHVSVTDMAERFYSELRRHYYTTPTSYLELINLYLGM 2681

  Fly  3127 LHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENEKVS 3191
            |.||.:.....|.|::|||.||....:.||.::..|...|..|..|:.:...|:..:..:.|...
Zfish  2682 LGEKRQQLQAARDRIKNGLTKLLETNELVDKMKQDLSALEPVLAQKSIDVSALMEKLAVDQENAD 2746

  Fly  3192 KERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDA 3256
            :.|....::|...:...|:..|.|...:.|..:|.|||.:|.:|||.|:|.:::|::.|..|||.
Zfish  2747 QVRRVVKEDEALAKVKAEETQAIADDAQRDLDEALPALDSANKALNALDKADISEMRVFTKPPDL 2811

  Fly  3257 VVSVCGAVLVLFSSKGKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIKALQPYILDAE 3321
            |::|..||.:|.|:|      ..|.:.:..:|: ..||..|::|||.:|.|.:::.|..||.:.:
Zfish  2812 VMTVMEAVCILLSNK------TDWASAKQLLGD-GNFLKKLMDYDKDNIKPQILQKLHKYISNPD 2869

  Fly  3322 FSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTELE 3386
            |.|||:...|.|...:|.||..::.:..|...|.||...|..::.|:......|.....:|.|:|
Zfish  2870 FVPEKVEKVSKACKSMCMWVRAMDLYSRVLKEVGPKREKLAAAQVELDATMSTLKEKQNKLQEVE 2934

  Fly  3387 EQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGD 3451
            .|:..||.:::.::|:|:......:.|...:..:.:|...|..|::||.||:.:....|..:.|:
Zfish  2935 NQIKVLQEQFESSMAEKETLAKTMALTEARLGRSGKLTSALGDEQVRWQESITLFEQEIHNVIGN 2999

  Fly  3452 ILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQGLP 3516
            :.|.:..::|.|.||..|||.|.:. |:...::.  .||.:|......::.|..:|.:||.:|||
Zfish  3000 VFIAAACVAYYGAFTSHYRQLLIDH-WITRCQSL--GIPISDNFSLIGILGDPYEIRQWNAEGLP 3061

  Fly  3517 SDRMSAENAAILVQSERYPLMIDPQLQGIKWVKTK-YGTGLVVLRLSQRNYLDQVERAVSNGSVL 3580
            .|.:|.||..::::..|:|||||||.|..:|:::| ...||.|::|:...:|..:|.|:..|..:
Zfish  3062 RDNVSTENGILVMRGRRWPLMIDPQDQANRWIRSKETKNGLKVIKLTDAGFLRTLENAIRLGMPV 3126

  Fly  3581 LIENIGENIDPVLNPLLGRQLIKKG--TVLKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQTT 3643
            |:|.:.|.:||.|.|:|.:|....|  |::::||.:||::..||..:.||:|||||.||:..:.|
Zfish  3127 LLEELKETLDPALEPILLKQTFVSGGRTLIRLGDSDIDYDKNFRFYMTTKMANPHYLPEVCIKVT 3191

  Fly  3644 LINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNVLE 3708
            :||||||:.|||||:|::||::||||||..|::|..:.|..:..||.:||.:|..|.::..|:|:
Zfish  3192 IINFTVTKSGLEDQILSDVVRLERPDLEEQRSQLIVRINADRNQLKAIEDRILKLLFTSEGNILD 3256

  Fly  3709 DVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIYQF 3773
            :..||..|:::|.|:..|:.::.||:.|...|:.|||.|||.|.|.||:||::..|.:|:|:|||
Zfish  3257 NEELVQTLQESKVTSQAIKSRLVEAETTEEMINRAREKYRPVATRGSIMYFVIASLSEIDPMYQF 3321

  Fly  3774 SLKAFTVVFNNAMLKAMAAEKLKD---RVENLIDSITFCSFVYTSRGLFEQDKLIFLTQLCIQIL 3835
            |||.|..:|||.:   .:|||.||   |::.|:|.....::...|||||||.|.|:...||::|:
Zfish  3322 SLKYFKQLFNNTI---ESAEKHKDLSLRLQILLDQTLLSAYTNVSRGLFEQHKAIYSFMLCVEIM 3383

  Fly  3836 VNLGEVEPTELDFLLR--------FPYMPNQTSNFTWLTHVGWGGIRALNNQ-AVFKGLEKDIEG 3891
            :..||:...|..:.||        .|..|    ...||:...|.....|.:: ..|.|::|:|..
Zfish  3384 MQRGEISQQEWLYFLRGAGGIRKELPEKP----EVPWLSDFAWETCCNLEDRLPCFNGIKKEIIS 3444

  Fly  3892 --------------SHKRWKKFVDSESPENEKFP--------GEWKGK-SAIQRLCIMRCIRPDR 3933
                          |.:.|..:|....|.:|:.|        |.|..: .|.|:|.:::....::
Zfish  3445 TPISVKLGQLEVTVSPEHWDGYVTDLPPFSEEIPSEKQPQVRGHWNQQLGAFQKLILIKSFMEEK 3509

  Fly  3934 MSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDH 3998
            :..|:..|:...||.::::...::.:..:.:.||...:.|:||.|.||:...::.....|:   .
Zfish  3510 VVSAVTEFVITGLGQQFVENPPVDLTTLYADMSPSIPLVFILSTGSDPMGAFQRFANEKGY---Q 3571

  Fly  3999 ENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLE---KKMESSLSNVHTSYRL 4060
            :...|:||||||..:||..|:.|.:.|.|:.|||.||...|:.::|   |......:.:|..:||
Zfish  3572 DRVKSISLGQGQGPIAERMIKEALKNGIWIFLQNCHLAVSWMLAMEELIKSFNEPDTVIHEDFRL 3636

  Fly  4061 FLSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFS 4125
            |||:.|     .::.|..:|::::|:|||||.|:.||:.:|....|....|......:::.|:|.
Zfish  3637 FLSSMP-----TNVFPVTVLQNSVKVTNEPPKGLRANVRRAFTEISSTFFEEHILGRKWRKIIFG 3696

  Fly  4126 LCYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHI 4190
            :|:|||::.||:||||.|||..|.||..|...::..|..|.:.. .:||:.|.|:.|||.|||.:
Zfish  3697 VCFFHAIIQERKKFGPLGWNIRYEFNDSDRECALLNLNLYCQTG-HIPWDALTYITGEITYGGRV 3760

  Fly  4191 TDDWDRRLCRTYLEEFMQPELIDGELEYCQG--FPAPGILKYTGYHNYIDDNLPSESPSLYGLHS 4253
            ||.||:|..||.|:.|.....::....|.:.  :.||.....|.|..||:|....:.|.::|:|.
Zfish  3761 TDAWDQRCLRTILKSFFSLATLEEGYTYSKSGIYFAPDSDSLTEYKQYIEDLPLIDDPEVFGMHE 3825

  Fly  4254 NAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFN-------- 4310
            ||.:.|....:..:...:.|:||| :..:.||:  |.::::..:::.||.|.|...:        
Zfish  3826 NANLAFQRQETMTVINTILEVQPR-SSAAGGGK--SNDEVVHELVDSILAKIPDKLDMDAAVESL 3887

  Fly  4311 -ILELMGRVEDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQ 4374
             :.:..|||...:   .|..||.:|.|.|:..||.||..|...:.|.:.:|..||.:......:|
Zfish  3888 FLQDPKGRVNSLT---TVLGQEVDRFNFLLRVLKTSLCTLQKAIAGLVVMSEEMEKIYNSFLNNQ 3949

  Fly  4375 VPEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARK 4439
            ||:.|:..||||:..|.||..||.||...:|.|:.. ..|.|.|::|||.||..||..:|..|||
Zfish  3950 VPDHWSNAAYPSLKPLGSWVRDLNLRTAFIESWITR-GQPKSFWISGFFFPQGFLTGALQNHARK 4013

  Fly  4440 NEWPLDRMCLNCDVTKKWKEEL-------TTAP-------------REGAYINGLFMEGARWDMK 4484
            ...|:|.:....::...:::::       |.||             .:|..::|:||:..|||..
Zfish  4014 YNLPIDELNFRFNMVPVYRDQILVTEAQKTLAPGKELDMDQELPNMEDGVLVHGMFMDACRWDDT 4078

  Fly  4485 MGTIADAFLKELFPAMPVLYIKAVTQDKQDIKNVYECPVYKIRLRGPT---------FVWTFNLK 4540
            ...:.||..:.:.|.:||::.:. .|:.....::|..|:||...|..|         ||.|..|.
Zfish  4079 SMVVEDALSRVMNPMLPVVHFEP-QQNYVPEPSLYHAPLYKTSARAGTLSTTGHSTNFVVTVMLP 4142

  Fly  4541 SRERASKWTLAGVCLLLQ 4558
            |.:.:..|......||.|
Zfish  4143 SNQPSDYWISKASALLCQ 4160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 10/64 (16%)
DHC_N2 1368..1770 CDD:285579 115/428 (27%)
P-loop_NTPase 1903..2132 CDD:304359 143/229 (62%)
P-loop_NTPase 2217..2352 CDD:304359 60/144 (42%)
P-loop_NTPase 2510..2783 CDD:304359 92/276 (33%)
P-loop_NTPase 2860..3127 CDD:304359 112/269 (42%)
MT 3140..3480 CDD:289543 99/340 (29%)
AAA_9 3509..3722 CDD:289547 90/216 (42%)
Dynein_heavy 3864..4549 CDD:281078 218/752 (29%)
dnah6XP_021326862.1 DHC_N2 895..1304 CDD:312039 114/415 (27%)
MT <1126..3778 CDD:330758 977/2700 (36%)
Dynein_heavy 3416..4158 CDD:308587 219/759 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492at2759
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.