DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and dnah1

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_012816961.1 Gene:dnah1 XenbaseID:XB-GENE-920106 Length:4204 Species:Xenopus tropicalis

Alignment Length:4545 Identity:1403/4546 (31%)
Similarity:2237/4546 (49%) Gaps:701/4546 (15%)


  Fly   332 GH---SRYFHTLNNMTLFFN-LFH--NSLIDCVNR--TVEPDSIFQGDVDEAYKKLDINMQHLEY 388
            ||   .|.:.|:.....:.: |.|  :||:..||.  .|:||.:.|.|.:....|          
 Frog    36 GHCLPPRKYPTMKQRGFYSDILTHTASSLLRDVNAGPHVQPDLLRQADQEHNTPK---------- 90

  Fly   389 YKLIYNECRNSLKKFKIGTTFNSQDWTWHQDEIFGRLDKFLVRLEELKDLFNTVRDFQK------ 447
                       :..|:|.:.|.    |:...::.|...:.|::           .||.|      
 Frog    91 -----------VTSFQIPSNFQ----TYIDKQVIGPTTEVLLK-----------SDFAKGGYEPK 129

  Fly   448 --LEKIVMGGLKGRQITFALEKILEEYNSIYREWTNIQYNPIDPDAENSLFQRDRLSFKAKTDVM 510
              |..:|..|...|:|  .||:..:||                                .|.|:.
 Frog   130 VQLPFLVAPGQCPRKI--ELERRRQEY--------------------------------MKLDIA 160

  Fly   511 ERMVSFQFEKGLEDTHDLLL---------------AGSLLLRPIIKKHVEPLMHVIVDDFEEEIM 560
            :.::|    ||::.  :||:               .||||...:      ||  .:.||.|.:: 
 Frog   161 KLLIS----KGIDS--NLLMPRHTDAKNLPSIGQRTGSLLPTYL------PL--EVFDDEEYDV- 210

  Fly   561 CVKKEFINFKNVFT---ALGLNE-------------LPTDDCFPKVSGAISFLKKLRHRIIGLHK 609
                      ..:|   :||..|             ||.||                  ::|   
 Frog   211 ----------RTWTDWLSLGYEEGSTERKPIPGKALLPVDD------------------VLG--- 244

  Fly   610 EHELYEYPLFDNERGGYVSDIFNIMVQEIDDFTKMLLDKWTVECWQGI---QQDITLTLIEKDEA 671
             |:                          |.....|:.:|   |..|:   .|:..|.|:.|..:
 Frog   245 -HD--------------------------DPKNPKLVYEW---CSVGVLDYDQERKLYLVHKATS 279

  Fly   672 NELRVNFTERLIFALKDIKVVRLLGCDVSVNLTKFFCREDELWQARVKLMRIAEWYNDTFERAHP 736
            |.| :|..        ||...:..|..||......:    |.|..|::|:..||         :|
 Frog   280 NRL-LNSA--------DITSYQRNGSSVSAATLNLY----EYWVPRIRLLFCAE---------NP 322

  Fly   737 TE--KRLIAAEMILIEEQMKPLL------DFIKWNAFSQRFIVMIFKMVKYLHDRLVAAQENLEA 793
            ..  ||::||..  :.::.:.||      |.:..|.                  |.|...|:|..
 Frog   323 RRFAKRIVAANK--LRKKTEALLLYNLYIDCMPGNG------------------RCVIPSESLNR 367

  Fly   794 IKESIRSWGKVP-----LFQRKDLNPALLLHTDPREPILSIRAANAADTQRLI----DLLMYVNL 849
            :|:.:.|...:.     |.|.|.|...:.:..:        |..|.....:|:    ....||.|
 Frog   368 MKQWLLSTSHMKQDDGVLHQLKILEMEISMEYE--------RTMNKLTFDQLVTSNPQKFAYVTL 424

  Fly   850 KLFFDIPRRYSLPPGEHGEED------EESDGIW--------PPII--------------SLSVM 886
                  |.|......|||..:      .::...:        |.:|              |:::.
 Frog   425 ------PDRVEEMVPEHGLVNVPEYNYAKNQAAFTFKTLLTRPEVITSLCKVRVECNRVSSMTLF 483

  Fly   887 TSVKFKKKREVIDEEDDLEEFEEEQSESEEEIITPFHRYELLKGLSQEERALFRE---------- 941
            .|...|..|        |||||:.||::..: :..|.:...:..|....|:..|:          
 Frog   484 HSSMAKCVR--------LEEFEQTQSQTFSQ-VQLFLKDSWVSTLKNAVRSSLRDVGKGWYDLHE 539

  Fly   942 --YEIY-------VDEIIAENLVDSV-------ITSSTYLRME------------------VDNR 972
              :|:|       :.|:|..||.||:       :.|.|.|.|:                  |::.
 Frog   540 CNWEVYQMSKLRQLMELIKFNLQDSLRFLVQDSLVSFTQLIMDACCSVLSCTEDMDWGGDLVNSP 604

  Fly   973 YE-NNTPIFEIFMELQEPNVVYFRNLDTSSKTGFAFFIETILDDMNNMMSLLKRVAQD------P 1030
            |: ...|||.:.:.|....|.:...|:....|..:.|.:.|| ..:::..|.|.|.:|      |
 Frog   605 YKPRKNPIFLLDLVLDNSGVHFSTPLENFELTLMSLFDKGIL-ATHSVPQLEKFVLEDLFICGTP 668

  Fly  1031 -TEVTNMNPYSFYDELQDKSELDKQRVEIMNKIKLALQAVRVHGKGFMEFSSLWIWDKSTYLSEV 1094
             .|...::          :..:::.|.:|...|..||..:|.:.|.:.::..|...|..||:   
 Frog   669 LLESVGLH----------EPPVEELRKDIRTAICKALIPLRSYAKQYEKYLELNNTDLETYI--- 720

  Fly  1095 KKFGRNLTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKFIELQDQIRTWETYEDFFVFLR 1159
                       ||.::....:..:||...|.   .:.||:||..:.....:..::          
 Frog   721 -----------RDFQSKNSSALNIKLAVQEN---LLEKERLDNALPSSIIVGPFQ---------- 761

  Fly  1160 LNMTGFKVAVLSQVGQWISLFKLDLINRVKNSLKELQDFVDEANIVLKIELQK-DDFEGLVKILS 1223
            :::.|.| ..||:..:.:|...|:|:  .|:..||:.|..|:...:.:...:| :..|.|.::..
 Frog   762 ISIEGVK-QNLSRKRRNLSNALLELL--AKSLRKEMDDISDQFRAISRSVYEKPNSIEELTELRE 823

  Fly  1224 VLNQINEKQCIYD-------SMFDPLKEIIDLLRQYNYEFK--------------DTELAQINEL 1267
            .:..:.||....:       |.:|.:.|.:..|.|.::..|              |:...|..|.
 Frog   824 WMKGVPEKLKTLEEQITKVTSDYDVIDEFLYSLSQEDFSAKWNVIAWPNKVMVLMDSICEQHTED 888

  Fly  1268 PDAWMKVKRLAAT-------TKQLIAPIQSYQVDLIEKRILLCDNMANTYRKKFLSKKFFFVPCL 1325
            .:.:.|::.:..|       :.|::....|..||     |.....:||..|:             
 Frog   889 EEKFRKIQVMDQTNFLERLDSLQMVVAGFSTHVD-----ITRAHEIANEVRR------------- 935

  Fly  1326 SCYELIDESDLELVALEERQRSLAESAVLFELQGPDPVKIELCRFD--LKLVKIMWDFAITIQST 1388
             .::.:.||....:....|:|       ||.|    ||    ..:|  :::||....|. .:.:|
 Frog   936 -VHKQLKESQQMALLYNNRER-------LFGL----PV----TNYDKLVRMVKAFQPFR-DLWTT 983

  Fly  1389 INDWKK-------TPWKKIDIENMDQ----------ECKKFGREL-------RGLDKAMRTWEPF 1429
            .:||.:       .|...||.|.:::          :|.|..|::       :.:.:.:..:.|:
 Frog   984 ASDWMRWNESWMNDPLTTIDAEQLEKNVTESYKVMHKCIKQFRDIPACQEVAQDIKERIEEFRPY 1048

  Fly  1430 IFMEASLKNLMTSLRAVTELQNPAIRDRHWIELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVK 1494
            |.:             :..|:||.:|:|||..|.:..::......:......:::||.::.:.:.
 Frog  1049 IPL-------------IQGLRNPGMRNRHWELLSEQIQINIKPKANLNFTRCLEMNLQDHIDSIA 1100

  Fly  1495 NIVDKSVKEMAMEKQLRDIATAWGTMEFGTDIHDRTSIKLLKASEELIETLEDHQGQLQNMASSK 1559
            .:.:.:.||.|:|:.|..:...|.::.|....:..|...:||:.||..:.|:||....|:|:.|.
 Frog  1101 KVAEIAGKEFAIEQALDKMENEWASVLFTILPYKETGTFILKSPEEASQLLDDHIVMTQSMSFSP 1165

  Fly  1560 YIAFFEHEVRLWQNRLSNADQIIGSWFEVQRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFK 1624
            :...||..:..|:.:|.....::..|...||.|.|||.|| .||||..|||.:.:|:..:::.::
 Frog  1166 FKKPFEERISTWEGKLRLTQDVLEEWLICQRSWLYLEPIF-SSEDINRQLPVEGKRYQTMERTWR 1229

  Fly  1625 ALLAQMNADRNVVRSTNRSGSKLYEHLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLD 1689
            .::.....::.|:.....  .:|.|.|....|:|.|.:|.|::||||||.::|||||:|..:||:
 Frog  1230 KIMKNAEENKQVISLCPE--PRLLESLRECNKLLELVQKGLSEYLETKRAAFPRFYFLSDDELLE 1292

  Fly  1690 ILSNGNNPALVARHLTKLYDSMGKLNLISGSKNAAGMVAKELEEYVPFLENCDCSGKVEVWLNRI 1754
            |||...:|..|..||.|.::::.:| |.........|.:.|.|| |...:....:|.||.||..:
 Frog  1293 ILSQTKDPTAVQPHLRKCFENVARL-LFQHDLQITHMYSAEGEE-VKLSKAIYPTGNVEDWLFEV 1355

  Fly  1755 TDKMRDTLRDQLKRSLTFYDHKPRHVWIFEWPAQPALVGTQIMWTTETNDAF--AKVQQRYENAL 1817
            ...|:.::|:.::||:..|...||..|:..||.|..:.|.|..||.:.::|.  ..:..|....|
 Frog  1356 EKVMKASVREYIERSIKVYPETPRTEWVLNWPGQVTIAGCQTFWTKDVSEALDAGDLSNRLFPQL 1420

  Fly  1818 KDYNKKQITQLNNLIILLLGDLTAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLR 1882
            :       :||:.|:.|:.|.|:..:|..:..:..|:||::||...:|.:.|.....|:|.||||
 Frog  1421 E-------SQLSGLVALVRGKLSRMQRSILSALIVIEVHAKDVAARLIEENVSSVNDFEWISQLR 1478

  Fly  1883 HRWDPKIDDCFANICDAQFRYDYEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGK 1947
            :.|  ..||.:....:|:|.|.|||||||.||||||||||||:|||.:|||..||||||||||||
 Frog  1479 YYW--ARDDLYVRAVNAEFLYGYEYLGNTGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGK 1541

  Fly  1948 TETTKDLGRALGMMVYVFNCSEQMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKC 2012
            ||||||||:||.:...|||||:|:|:.::|...||||.:|||.||||||||.:|||||||.|:..
 Frog  1542 TETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASSGAWACFDEFNRIDIEVLSVVAQQITT 1606

  Fly  2013 IQDAIKSKKQTFSFLGEHIALRTTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEI 2077
            ||.|.:.:...|.|.|..|.|.||..||||||||||||.|||:|||||:||.||:|||:|:|:||
 Frog  1607 IQKAQQQRVDRFMFEGVEIPLVTTCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMIAEI 1671

  Fly  2078 MLVAEGFQEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGALRRDDRQRPEDQVLM 2142
            .|.:.||..|::||:|..|.:.|..|.||.|||||:|:||:|:|:..||.|:|::....|:.:.:
 Frog  1672 SLYSFGFNNAKILAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPTMNEELICL 1736

  Fly  2143 RALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQ 2207
            ||:||.|:||.:.||:.:|.|::.||||.::.........|..|:::.:...|:..|||:.|.:|
 Frog  1737 RAIRDVNVPKFLQDDLKLFSGIVSDLFPRIEEEHIDYGTLEEAIRKTCVQKNLKDVDGFVTKCIQ 1801

  Fly  2208 LEELFAVRHSVFIIGFAGTGKSEVWKTLNKTYQNQKRKP----------HYNDLNPKAVTNDELF 2262
            |.|...|||.:.::|..|:||::.:|.|.....:.|..|          ||..||||::|..:|:
 Frog  1802 LYETTVVRHGLMLVGPTGSGKTQCYKVLAAALTSLKGLPSVSGGTYETVHYYILNPKSITMGQLY 1866

  Fly  2263 GIVNPSTREWKDGLFSILMRDQANLGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERI 2327
            |..:..|.||.||:.|.|:|..|.......:|.:.||.:|.:|||::|||:||||.|.|:|.|.|
 Frog  1867 GEFDLLTHEWTDGILSSLIRGGATSTDPDRRWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEII 1931

  Fly  2328 ALTKEMRLLFEIASLRTATPATVSRAGILYINPQDLGWTPFIQSWLGTRTNSSE--VSMLNVLFD 2390
            .||:.|.::||:..|..|:||||||.|::|:.|..||.|||.:.||....:..:  ...|..||.
 Frog  1932 KLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLTPFTECWLRCMPDVIKPFTEKLESLFS 1996

  Fly  2391 KYVPPLLDIFRTRLRSITPI--SDIARLQMTCY-LLDSMLTPQNVPNDCPK-----------DWY 2441
            .:   |||..|...||:..:  |....|.|:.. |||....| .:|.:..|           :..
 Frog  1997 HF---LLDSIRFVRRSVKEMIASTDNNLTMSLLKLLDCFFQP-FIPQEGQKKFPEEKLRRIEELI 2057

  Fly  2442 EIYFVFCIVWGFG-SSLFQDQIIDWSNEFSKWFLNEYKAVK----FPLSGTIFSFYID------- 2494
            |.:|.|.::|..| :...|.:::     ||.|..::.|:.|    ||..|.:..:.:|       
 Frog  2058 ESWFFFSLIWSVGITGDSQGRVL-----FSTWLRDKMKSEKIAMLFPEQGLVHDYKLDDAGISNA 2117

  Fly  2495 -----HETKKFFPWTNLVP---QFELDMDLPLQSNLVNTAETTRLRFFMDTLIEADHPLMLIGPS 2551
                 .:.:|...|.|.:.   .|.:..|......:|.|.:|.|:...:..|:....|::.:||:
 Frog  2118 SEEDEEDVQKPICWVNWMDSAGSFSIVPDTSYADIIVPTLDTVRMSHLLGMLLTNKKPVLCVGPT 2182

  Fly  2552 GSGKTILMNAKLSALPSDKYSVTNVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVD 2616
            |:|||:.:..||......:|....:.|:..|::...|.:::..|:|:....:||...:..|:|:|
 Frog  2183 GTGKTLTITDKLLKNFPMEYISHFLMFSARTSANQTQDLIDSKLDKRRKGVFGPPLGRYYIFFID 2247

  Fly  2617 DMNMPEVDKYFTVQPHTLIRQFMDYHHWYDRQKM-TLRDIHKCNIVACMNPSAGSFT-IDPRLQR 2679
            |:|||.::.|....|..|:||:||:..||||::: ..:.:...|.:..|.|..|... :.|||.|
 Frog  2248 DLNMPSLETYGAQPPIELLRQWMDHGGWYDRKQIGVFKQLVDINFLCAMGPPGGGRNPVSPRLTR 2312

  Fly  2680 HFCSFAVNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAI 2744
            ||...:.......:...|.:|||...:...     .||..|.|.:|:..|.::..:.|..|||..
 Frog  2313 HFNYLSFTELEDSSKSRIFSSILGSWLAGA-----SAVQNLTEQLVSATIKVYNTITSQLLPTPA 2372

  Fly  2745 KFHYNFNLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIV 2809
            |.||.|||||::.:|.|:|.:::....:..|:::||.||..||:.|:||:..|.:.|.::....:
 Frog  2373 KSHYTFNLRDLSKVFQGMLMADASKMGDKYQLLKLWYHESCRVFQDRLVNEEDRSWFDELFKGKM 2437

  Fly  2810 RKGIEGVN-DDVVYAQPLIYCHFAKGLTDIK-YMPISGWDRLKSLLDEAQDRYNDYIGA-MNLVL 2871
            ::  .|.: .:||..||:::..|....:|.| |..|...::|..:::|..:.||....| |.|||
 Frog  2438 QE--FGASFHEVVPQQPVLFGDFMSPGSDAKAYQLIEDREKLHRVIEEYMEDYNQINTAKMKLVL 2500

  Fly  2872 FDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVSDLKANI 2936
            |.||:.|:|||||:|....|.|||:||||||:||||||||.::..:.|||:|:|:|..|:.:.:|
 Frog  2501 FLDAIQHICRISRVLRQPLGNALLLGVGGSGRQSLTRLASNMAQYECFQIELSKNYGRSEWREDI 2565

  Fly  2937 ATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRNEVKQLG 3001
            ..:.:|||::.:...||.||:::..|.||..:|::|.|||:..|:..||::.||..::..|:.:|
 Frog  2566 KGILLKAGLQNTPITFLFTDTQIKDESFLEDINNILNSGDVPNLYGPDELDQIVTVMKPVVQDMG 2630

  Fly  3002 IVDNRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQALESVSL 3066
            ....:.|....:..:||..:..|||.||:|...|.|.|:||:||.|.|||||.|||.:||:||:.
 Frog  2631 QQPTKANLMAAYTRRVRGNIHTVLCMSPIGEVFRSRLRQFPSLVTCCTIDWFDEWPAEALQSVAS 2695

  Fly  3067 RFLSEITVL-PKELALP-VSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALYSKLLHE 3129
            .|||||..| .:|..:| :......:|::|...||.|||...|:||.||||:|||:.::|||:.:
 Frog  2696 SFLSEIPELQSREDIIPGMIQMCVDIHQSVAVKSKQYLAELSRHNYITPKSYLELLGIFSKLIGK 2760

  Fly  3130 KVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENEKVSKER 3194
            |:......:.|:::||.||.:..::|..:|:.|:|....|:   :.|.:.:    |..:|:.::.
 Frog  2761 KLMEIKTAKDRMKSGLDKLLTTAEDVAKMQEELEVMRPLLE---EAAQDTV----TTMQKIQEDT 2818

  Fly  3195 AFASKEEKNVRQIEEDVTAKAKL-------CEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGS 3252
            ..|.....:|:..|...|.||:.       .::|..:|.|||.||..:|.:||||::||:::...
 Frog  2819 VVAEATRGSVQVEEAKATEKAQTAQAIADDAQKDLDEALPALDAALASLKSLNKNDVTEVRAMQR 2883

  Fly  3253 PPDAVVSVCGAVLVLFSSKGKIPK-----------DRSWKACRAFMGNVDKFLDNLINYDKKHIH 3306
            ||..|..|..||.::   ||..||           |..|:..:..:.:..|||:.|..:||.:|.
 Frog  2884 PPVGVKLVIEAVCIM---KGIKPKKVAGDKPGSKIDDYWEPGKGLLQDPGKFLEGLFKFDKDNIP 2945

  Fly  3307 PDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDA 3371
            ..||||:||||.:.||.|..|...|.|...:|.||..:::::.|...||||.:||.|:::::...
 Frog  2946 DAVIKAIQPYIDNEEFQPAAIARVSKACTSICQWVRAMHKYHFVARGVEPKRQALREAQEDLAVT 3010

  Fly  3372 RDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWME 3436
            :..|.|...||.::|:.:..||.:|.:.::||::.:.:..:....:..|::||.||:.|:.||.:
 Frog  3011 QKILDAAKARLRDVEDGIATLQAKYRDCVSKKEELEHKCEQCEQKLGRADKLITGLSDERQRWQD 3075

  Fly  3437 SVKVLTFGIQQLPGDILIISCFISYVGCFTRAYR--------QELQEKLWMPAFKNSQPPIPSTD 3493
            :|..|...:..:.||:|:.:.|::|:|.||..||        ::||| |.:|.  :.:|.:..|.
 Frog  3076 TVLNLENLLVNVAGDLLLCAGFLAYLGPFTGPYRTTLFNQWTKKLQE-LKVPC--SEEPSLIGTL 3137

  Fly  3494 GVDPFEMICDDAQIAEWNNQGLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKT-KYGTGLV 3557
            |        |..:|..|...|||:|.:|.||..|...|:|:...||||.|..:|:|. :...||.
 Frog  3138 G--------DPVKIRSWQIAGLPNDTLSVENGVITQYSQRWSHCIDPQGQANRWIKNMEKDNGLE 3194

  Fly  3558 VLRLSQRNYLDQVERAVSNGSVLLIENIGENIDPVLNPLLGRQLIKK--GTVLKIGDREIDFNSR 3620
            |.:||.|::|..:|.|:..|...::||:||.:||.|.|:|.:|..|:  .|||::||..|.::..
 Frog  3195 VAKLSDRDFLRSLENAIRFGKPFMLENVGEELDPALEPVLLKQTYKQQGSTVLRLGDAVIPYHDD 3259

  Fly  3621 FRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFK 3685
            ||:.:.|||.||||.||:..:.||||||::..|||||||.:||..||||||..:.:|.......:
 Frog  3260 FRMYITTKLPNPHYPPEICTKVTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLILSNAKMR 3324

  Fly  3686 ITLKFLEDDLLARLSSAGDNVLEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPA 3750
            ..||.:||.:|.|||::..|.::||.|:..||.:|:.|.||:|||..|:.|...|||.|..|.|.
 Frog  3325 QELKDIEDQILLRLSTSQGNPVDDVDLIKVLEASKQKAGEIKVKVQVAEQTERDIDSTRRQYVPV 3389

  Fly  3751 AERASIIYFILNDLFKINPIYQFSLKAFTVVFNNAMLKAMAAEKLKDRVENLIDSITFCSFVYTS 3815
            |.|..|::|.::||..::|:||:||:.|..:|..|:..:..||.::.|:.|:....||..|....
 Frog  3390 AVRTQILFFCVSDLSNVDPMYQYSLEWFLSIFIAAIANSERAETVEKRIININTYFTFSLFSNVC 3454

  Fly  3816 RGLFEQDKLIFLTQLCIQILVNLGEVEPTELDFLLR-----------FPYMPNQTSNFTWLTHVG 3869
            |.|||:.||:|...||::||:|.|.:...|..|||.           ||         .|||...
 Frog  3455 RSLFEKHKLMFSFLLCVRILMNQGLIHMEEWRFLLSGGTASSLAENPFP---------EWLTERA 3510

  Fly  3870 WGGIRALNNQAVFKGLEKDIEGSHKRWKKFVDSESPENEKFPGEWKGKS--AIQRLCIMRCIRPD 3932
            |..|:||:..:.|..:.:.:....|.::...||..|..|:.||.| |:|  :.|::.|:||:|.|
 Frog  3511 WRDIQALSALSNFSKITEQLTHYAKEYRGLCDSPEPHREQLPGNW-GQSLDSFQKILILRCLRGD 3574

  Fly  3933 RMSYAMRSFIEEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFD 3997
            :::.||:.::.:.||.::|:.::.:....::||||.|.:.|:||||.||..|:.|..:.:.||  
 Frog  3575 KVTNAMQDYVCQHLGQRFIEPQTADLGAVYKESSPVTPLIFILSPGTDPAADLYKFAEEMKFS-- 3637

  Fly  3998 HENFHSVSLGQGQEIVAENAIEIASQYGHWVILQNIHLVARWLPSLEKKMES-SLSNVHTSYRLF 4061
             :...::||||||...||..:..:.:.|.||..||.||...|:||||:.:|: ....||..:|::
 Frog  3638 -KKLSAISLGQGQGPRAEAMMRSSMERGKWVFFQNCHLAPSWMPSLERLIETIDPDKVHRDFRVW 3701

  Fly  4062 LSAEPAGDPAAHILPQGILESAIKITNEPPTGMMANIHKALDNFSDETLEMCSKETEFKAILFSL 4126
            |::.|:..     .|..||::..|:|.|||.|:.||:.:...:.||..|:.|||.::|||:|.||
 Frog  3702 LTSMPSNQ-----FPVSILQNGSKLTIEPPRGVKANLLRTYLSLSDAELQDCSKASQFKALLLSL 3761

  Fly  4127 CYFHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHIT 4191
            ..||....|||||||.|:|..|.|..|||.|.:..|..:||..:.:|::.|||..|||.|||.:|
 Frog  3762 SLFHGSTLERRKFGPLGFNIPYEFTDGDLRICISQLRMFLEEYSDIPYKVLRYTAGEINYGGRVT 3826

  Fly  4192 DDWDRRLCRTYLEEFMQPE-LIDGELEYCQGFPAPGILK-------YTGYHNYIDDNLP-SESPS 4247
            ||||||...:.|::|.||. |.:|     ..|...||.:       ..||..|| .:|| ::...
 Frog  3827 DDWDRRCLLSILQDFYQPPVLTEG-----HNFSVSGIYQQISPAYDLNGYLQYI-RSLPLNDLTE 3885

  Fly  4248 LYGLHSNAEIGFLTTVSERLFRIVFELQPRMTGGSSGGETVSQEDIIKNIIEDILDKTPTPFNIL 4312
            |:|||.||.|.|....|..|...:..||||  ..||||   |::::::.|.|:||.|.|....:.
 Frog  3886 LFGLHENANITFAQNESFALLGSLVTLQPR--AESSGG---SRDEMVEEISENILKKVPPLIPVQ 3945

  Fly  4313 ELMGR--VEDRSPYIIVAFQECERMNNLMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQV 4375
            |:|.:  |..:.....|..||..|.|.|::.|.::|::|...:||::.:||.:|.:...||.:.|
 Frog  3946 EVMAKYPVMYQESMNTVLVQEVIRYNRLLSVLTQTLHDLLKAMKGQVVMSSQLELMANSLYNNSV 4010

  Fly  4376 PEQWTKLAYPSMLGLQSWFSDLMLRLRELEGWVADFRMPSSIWLAGFFNPQSLLTAIMQQTARKN 4440
            ||.|...||||:..|.||..||:.|::.|:.|::| .:|::.|::|.|.||:.||..:|..|||:
 Frog  4011 PEMWRSKAYPSLKPLASWVLDLLQRIQFLQKWISD-GIPAAFWISGLFFPQAFLTGTLQNYARKH 4074

  Fly  4441 EWPLDRMCLNCDVTKKWKEELTTAPREGAYINGLFMEGARWDMKMGTIADAFLKELFPAMPVLYI 4505
            ...:|.:..:..|.::...|||..|.||.||.|||:||||||.....:|::..|||:..|.|:::
 Frog  4075 VISIDTISFDFKVLRESVSELTQRPSEGCYIYGLFLEGARWDKTSSVLAESRPKELYTEMAVIWL 4139

  Fly  4506 KAVTQDKQDIKNVYECPVYKIRLRGPT---------FVWTFNLKSRERASKWTLAGVCLL 4556
            ..|.:.|.....:|.||:||...|..|         :|....|.|.:..:.|...||.|:
 Frog  4140 IPVPERKPATSGIYFCPIYKTLTRAGTLSTTGHSTNYVIAVELPSNQPQTHWIKRGVALI 4199

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 91/489 (19%)
DHC_N2 1368..1770 CDD:285579 112/428 (26%)
P-loop_NTPase 1903..2132 CDD:304359 146/229 (64%)
P-loop_NTPase 2217..2352 CDD:304359 57/145 (39%)
P-loop_NTPase 2510..2783 CDD:304359 81/275 (29%)
P-loop_NTPase 2860..3127 CDD:304359 122/270 (45%)
MT 3140..3480 CDD:289543 111/366 (30%)
AAA_9 3509..3722 CDD:289547 93/216 (43%)
Dynein_heavy 3864..4549 CDD:281078 257/708 (36%)
dnah1XP_012816961.1 Seryl_tRNA_N 764..856 CDD:299883 20/95 (21%)
DHC_N2 970..1371 CDD:285579 111/420 (26%)
P-loop_NTPase 1497..1727 CDD:304359 146/230 (63%)
P-loop_NTPase 1811..1957 CDD:304359 58/146 (40%)
P-loop_NTPase 2141..2411 CDD:304359 81/275 (29%)
P-loop_NTPase 2488..2758 CDD:304359 122/270 (45%)
MT 2770..3116 CDD:289543 107/356 (30%)
AAA_9 3146..3361 CDD:289547 93/215 (43%)
Dynein_heavy 3500..4192 CDD:281078 259/722 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.