DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kl-5 and dnah14

Sequence 1:NP_001015499.4 Gene:kl-5 FlyBaseID:FBgn0267433 Length:4559 Species:Drosophila melanogaster
Sequence 2:XP_017949452.1 Gene:dnah14 XenbaseID:XB-GENE-5960869 Length:4623 Species:Xenopus tropicalis

Alignment Length:4708 Identity:1273/4709 (27%)
Similarity:2109/4709 (45%) Gaps:874/4709 (19%)


  Fly   542 KHVEPLMHVIVDDFEEEIMCVKKEFINFKNVFTALGLNELPT-----DDCFPKVSGAISFLKKLR 601
            ||.:.|:..|..:.:.|..|:.:|.::.|.       .|||.     |:...|...|::::.|||
 Frog    96 KHRKELVGSISPETKSETFCLYREAVDRKE-------GELPVLSAQPDNEMTKEDSALAYIIKLR 153

  Fly   602 HRIIGLHKEHELYEYPLFDN---ERGGYVSDIFNIMVQEIDDFTKMLLDKWTVECWQGIQQDI-- 661
            .: :|...|.....:....|   :....:.|.|  .::|..:|...|...|.....|....|:  
 Frog   154 KK-LGWKTEISKTVFKRKCNMAKKCSSQIQDTF--ALKETGEFVYCLPRSWDNAKAQYDPYDLHV 215

  Fly   662 --TLTLIEKDEANELRVNFTERLIFALKDIKVVRLLGCDVSVNLTKFFCREDELWQARVKLMRIA 724
              ..|.|..|         |...:.|.:..||     |..|       .:||      :.::.:.
 Frog   216 VTAATAIHSD---------TYWTVSASQICKV-----CMTS-------AKED------MDIVPVT 253

  Fly   725 EWYNDTFERAHPTEKRLIAAEMILIEEQMKPLLDFIKWNAFSQRFIVMIFKM----VKYLHDRLV 785
            ||.:   ||.|           ....:.:|....|..|.||:      ::||    :|..:.|::
 Frog   254 EWLH---ERHH-----------FYAIKDLKVFSQFRLWKAFT------VWKMNVHRMKTNNSRVL 298

  Fly   786 AAQENLEAIKESIRSWGKVPLFQRKDLNPALLLHTDPREPILSIRA--ANAADTQR--------- 839
            .:|:...|.|.          ||               :.:|.|||  .||.:.|.         
 Frog   299 ISQQLFIADKG----------FQ---------------DCLLYIRALCENALNGQPGSNHAIKFV 338

  Fly   840 LIDLLMYVNLKLFFDIPRRYSLPPGEH-GEEDEESDGIWPPIISLSVMTSVKFKKKREVIDEEDD 903
            .||.....|||.|..|..:.......| |...|::..    .|:|:.:.:.:.|..:|:...||.
 Frog   339 TIDKQRTYNLKEFCAIQSKQCSHALAHIGIIREKAIS----AITLTYLKAAEGKGIKELFSSEDQ 399

  Fly   904 LEEFEEEQSESEEEIITPFHRY---------ELLKGLSQEERALFREYEIYVDEIIAENLVDSVI 959
            ::......:| .:.::..|.|:         |:|:.||      |...:.::..:.|...|.|..
 Frog   400 IKPKYTVLTE-WQTLVERFSRFLTLVDCIFQEMLRYLS------FSATQTFLGFLEASYSVTSTD 457

  Fly   960 TSSTYLRMEV-DNRYENNTPIFEIFME--------------LQEPNVVYF-----RNLDTSSKTG 1004
            ....:.|..: |.|.|...|..|...:              :.:|.:...     .|:|.:.:..
 Frog   458 EKKNHRRRSLSDGREETCFPFSESLNKNQLDPFKNNDKQHTMNQPEIARLLSDISGNIDGNEEAA 522

  Fly  1005 FAFFIETILDDMNNMMS-----------------LLKRVAQDPTE----VTNMNPYSFYDELQDK 1048
            ..|.:...|.:.:|...                 .|:.:...|||    :.|.:.....|:..||
 Frog   523 PLFEVNLTLSNQSNTAGHGSKLPAEGSHYSGKGVPLEELTHYPTETAEDLLNDDADDSGDDSNDK 587

  Fly  1049 SELDKQRVEIMNKIKLALQAVRVHGKGFME-----FSSLWIWDKSTYLSEV-------KKFGRN- 1100
            ..|::...:.:..:. :......|.:|.::     ...:..:.:.|.||:.       ||.|:. 
 Frog   588 EALERSLPKCVALVP-SRSEFETHIQGIVDGFEQAIGKITSFSQETRLSKFRSQPCQDKKVGKQK 651

  Fly  1101 ------------LTLDERDAEADLEGSSGVKLLGLEYPPLSVYKEQLDKF---IELQDQIR---- 1146
                        |.:|. |.::::...:.:....:|  .:.:|..|..||   :|..:.:.    
 Frog   652 INQQPWPNCELLLGMDP-DYQSNVSRMNAIVHAVME--EVEMYSGQFKKFCTMVEAAESVMGRMR 713

  Fly  1147 ----TWETYEDFFVFLRLNMTGFKVAVLSQVGQWISLFKLDLINRVK-----------NSLKELQ 1196
                ...|..|:...|.:    ||       |..|...::::..||:           :.|:.|:
 Frog   714 AALPAEPTPADYRNLLAM----FK-------GYIIDCKEMNIEARVRAIQVRSLDYQAHCLQHLE 767

  Fly  1197 DFVDEANIVLKI------------------ELQKD--DFEGLVKILSVLNQINEKQCIYDSMFDP 1241
            :.::..|..|.:                  :|.||  ..|..|:.|:.|.||:.:....:..:..
 Frog   768 NVIELINSTLPVRAYARNIQLLEVIDKAQRKLNKDLRGVEEFVEHLTFLGQISSEVPSLEREYST 832

  Fly  1242 LKEIIDLLRQYNYEFKDTELAQINELPDAWMKVKR-------------------LAATTKQLIAP 1287
            :.::..:.::||......|.|....|..::.::|.                   |.....||.:.
 Frog   833 IVQLYSIAKEYNMAISPEETAHYQSLIPSFQQLKSAVLFCEAKKDENIVRFSGDLDTYISQLHSE 897

  Fly  1288 IQSYQVDLIEKRILLCD-------NMANTYRKKF--LSKKFFFVPCLSCY-------------EL 1330
            :..::|.:....:|..|       .|.....::|  |:.|   ..|.|.|             :|
 Frog   898 LMEFKVKVRNPLLLQGDIFPREALEMITNLLEEFEVLANK---ARCYSSYQERFGSSMTHMKAQL 959

  Fly  1331 IDESDLELVALEERQRSLAESAVLFELQGPDPVKIELCRFDLKLVKIMWDFAITIQSTINDWKKT 1395
            :|    ||::.:..:..:....|..||...:.        :|.|.|::|:..........:||:|
 Frog   960 LD----ELLSQKNIKGVITSETVNAELSEAES--------NLNLRKLLWESKEEWVKLSTEWKQT 1012

  Fly  1396 PWKKIDIENMDQECKKFGRELRGLDKAMRTWEPFIFMEASLKNLMTSLRAVTELQNPAIRDRHWI 1460
            .::.::::.:.::..:|...|..|:|.:...:....:..|:.:...:|..|..|.||.::.|||.
 Frog  1013 AFELLNVDVIQRDVNRFSHTLFILEKGLPVNKVVASLRESVMDFKQNLPIVVALSNPCLKPRHWD 1077

  Fly  1461 ELMQTTKVKFSMDDSTTLKDLIDLNLHEYEEEVKNIVDKSVKEMAMEKQLRDIATAWGTMEFGTD 1525
            .:..||......:.:.||::|::|.:..:::::......:..|..:|..|..:.:.|...|....
 Frog  1078 TIQFTTGRSIPKEKNFTLENLLELKIFHHKDKIIETSTTATNEATLEGMLNKVISLWNKTELKLT 1142

  Fly  1526 IH--DRTSIKLLKASEELIETLEDHQGQLQNMASSKYIAFFEHEVRLWQNRLSNADQIIGSWFEV 1588
            .|  :.:.|.::..:||::..:|:.|..:..:..|:|:|..::.|..|..:||...:.:......
 Frog  1143 PHKSELSEIWIVACAEEVVGQIEESQVIVSTVKGSRYVAPIKNAVDEWDRKLSLFLRTMEELMIC 1207

  Fly  1589 QRKWQYLESIFIGSEDIRSQLPEDSRRFDYIDKEFKALLAQMNADRNVVRSTNRSGSKLYE---- 1649
            ||.|.|||.||:.| ||:.|||.::..|..:|..:|.::..:....:.:|:....|  |.|    
 Frog  1208 QRNWLYLEQIFLAS-DIQRQLPAEANLFFQVDSSWKEIMENIKERPSALRAAIAPG--LLEVLQN 1269

  Fly  1650 ---HLEILLKMLLLCEKALNDYLETKRLSYPRFYFVSSADLLDILSNGNNPALVARHLTKLYDSM 1711
               |||.:|       |.|.|:||.||..:|||||:|:.|||.|||...||.:|..||.|.::::
 Frog  1270 NNAHLEKIL-------KCLEDFLEIKRKVFPRFYFLSNEDLLAILSESKNPDVVQPHLVKCFENI 1327

  Fly  1712 GKLNLISGSKN--AAGMVAKELEEYVPFLENCDCSGKVEVWLNRITDKMRDTLRDQLKRSLTFYD 1774
            ..|::....|:  ...|:.....|.:....|....|.||.||..:...|.|.::..:|..:..:.
 Frog  1328 RHLDITFPMKSPPVVAMIRSAEGETIHMPNNIRIRGPVEQWLGNVESSMFDIVKKLVKLGVMDWG 1392

  Fly  1775 HKPRHVWIFEWPAQPALVGTQIMWTTETNDAFAKVQQRYENALKDYNKKQITQLNNLIILLLGDL 1839
            ......|:...|.|..|:.:|||::.:...:|.....  |..|:..:...:..|..|..:.|...
 Frog  1393 QSQFKKWMLSHPGQVVLLVSQIMFSKDCVRSFHSADP--EKELRLVHANLVEHLGQLADMALDIP 1455

  Fly  1840 TAAERQKIMTICTIDVHSRDVVGTIIAKKVEVQTAFQWQSQLRHRWDPKIDDCFANICDAQFRYD 1904
            ...::..:..:.|:.||.|||:..:|.|:|.....|:|..|||::|:.....|:|...:|.|.|.
 Frog  1456 LLHQKTTLEALLTLYVHCRDVLAELIKKRVSKSDDFEWTRQLRYQWNENNKTCYAVQGNATFHYG 1520

  Fly  1905 YEYLGNTPRLVITPLTDRCYITLTQSLHLVMGGAPAGPAGTGKTETTKDLGRALGMMVYVFNCSE 1969
            |||||.:.|||||||||||::|||.:|||.:||:||||||||||||.|||.:|||....||||||
 Frog  1521 YEYLGCSSRLVITPLTDRCWLTLTGALHLHLGGSPAGPAGTGKTETVKDLAKALGKHCVVFNCSE 1585

  Fly  1970 QMDYKSIGDIHKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCIQDAIKSKKQTFSFLGEHIALR 2034
            .:|||.:|....|:||:|||.||||||||.:|||||:|.|:..|:.|..|:...|.|.|..:.|.
 Frog  1586 GLDYKMMGKFFSGMAQSGAWCCFDEFNRIDIEVLSVIASQIHAIKTAKDSQVMRFVFEGREMRLN 1650

  Fly  2035 TTVGVFITMNPGYAGRAELPENLKALYRPCAMVVPDFALISEIMLVAEGFQEARLLARKFITLYT 2099
            .:.||||||||||.||.|||:|||:|:||.||:|||:.||:||||.:|||:.|:.|:.|.:.||.
 Frog  1651 MSCGVFITMNPGYKGRVELPDNLKSLFRPVAMMVPDYQLIAEIMLFSEGFKAAKSLSGKLVNLYQ 1715

  Fly  2100 LCKELLSKQDHYDWGLRAIKSVLVVAGALRRD-------DRQRPEDQ--VLMRALRDFNIPKIVT 2155
            |..:.||:|:|||:|:||||:|||:||..::|       .|..|.|:  :::|||::.|:||.:.
 Frog  1716 LASKQLSQQNHYDFGMRAIKTVLVMAGQKKQDLELGGQHVRLSPADESLIIIRALKEANLPKFLA 1780

  Fly  2156 DDVPVFMGLIGDLFPALDVPRKRNPEFEAVIKRSALDLKLQPEDGFILKIVQLEELFAVRHSVFI 2220
            :|||:|..::.||||.:.:.:......|..|..::.:|.|||.:..:.|::|.....|.||.|.:
 Frog  1781 EDVPLFENIMADLFPGVVIEKANTKRLEKAISLASHELGLQPWETQVEKVIQFHNQIAARHGVML 1845

  Fly  2221 IGFAGTGKSEVWKTLNKTY--------QN-------QKRKPHYNDLNPKAVTNDELFGIVNPSTR 2270
            :|.||.||:.|.:.|.|..        :|       :|.|.....:|||.||..||:|.|||:|.
 Frog  1846 VGPAGGGKTTVRRILEKALVYLPSLPAENSSPQHLLKKGKVETFTINPKCVTLGELYGEVNPNTM 1910

  Fly  2271 EWKDGLFSILMRD--------QAN----------LGGTGP------------------------- 2292
            ||.|||.:..:|.        ||.          :..:.|                         
 Frog  1911 EWTDGLLASAVRTVSQQQSKVQAKEKPPEPPNRPISASSPNEADGNTLENDISKSTNSGENIEYL 1975

  Fly  2293 ---------------KWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTKEMRLLFEIASL 2342
                           .||||||.:|.:|:|:||||:||.:.|.||::|||.|.:.||::||:.||
 Frog  1976 DSAQHHSRAFSIHDWNWIVLDGPVDTVWVENLNTVLDDTRTLCLANSERIQLPQGMRIIFEVDSL 2040

  Fly  2343 RTATPATVSRAGILYINPQDLGWTPFIQSWL---GTRTNSSEVSMLNVLFDKYVPPLLDIFRT-- 2402
            ..|:||||||..::|::|.||||.||:::||   ..:...:.|..|..||...||..|.....  
 Frog  2041 SQASPATVSRCAMVYMDPVDLGWKPFVKTWLNQISAKVPHAGVQYLESLFTMSVPEGLQFIHKHW 2105

  Fly  2403 RLRSITPISDIARLQMTCYLLDSML----------------------TPQNV--PNDC------- 2436
            :|:.. |:.::..:...|.:|::.:                      ..||:  |.:.       
 Frog  2106 KLQPF-PVQELGVVMTLCKILEAFIDFMGRNGGFGHIKDMILEEQHPVSQNILPPREVGTPERSY 2169

  Fly  2437 ------------PKDWY-EIY-----------FVFCIVWGF-----------GSSLF-----QDQ 2461
                        .:.|: |.|           :||...|.|           |.||.     .:.
 Frog  2170 TASLSVSSRTRGDQKWFLEKYPEKLVPLLGKLYVFAFTWAFGGVFKREDEHEGDSLIGLKVRDEA 2234

  Fly  2462 IIDWSNEFSKW----FLNEYKA-VKFPL-SGTIFSFYIDHETKKFFPWTNLVPQFE--------L 2512
            :::.:|:||.:    |..:.:: ::.|| ..::||:::|.:|..|.||..|||..:        |
 Frog  2235 LVNLTNDFSSFVRDMFAGDQRSGIQMPLGEDSVFSYFVDLQTGNFVPWHYLVPSTDSLIQRGSLL 2299

  Fly  2513 DMDLPLQSNL-------------VNTAETTRLRFFMDTLIEADHPLMLIGPSGSGKTILM----- 2559
            ..|..|...|             |.|.::.|..|....|:....|::|.|.||.||:.|:     
 Frog  2300 HSDFMLPDTLRAGESGGGAVREFVPTVDSLRYSFLTSLLLLHKQPVLLTGESGVGKSALIQNMFQ 2364

  Fly  2560 ---------------------------NAKLSALPS--------DKYSVT--------------- 2574
                                       |:.|.::.|        |..|||               
 Frog  2365 RIQKPGGLSVNTSTVLGDVFLFNESRKNSLLQSINSLTSGSVRDDSLSVTADDFDGSLIGVGADG 2429

  Fly  2575 ------------------NVPFNFYTTSEMLQRILEKPLEKKAGRNYGPIGNKRMIYFVDDMNMP 2621
                              .|.....|||..:|..::..|.||:....|...:|::..|:||:|||
 Frog  2430 WISARDQGYLRTSRLIVSTVQLGANTTSARIQAQIQNKLMKKSRDTLGAPKHKKVAVFIDDLNMP 2494

  Fly  2622 EVDKYFTVQPHTLIRQFMDYHHWYDRQKMTLRDIHKCNIV-ACMNPSAGSFTIDPRLQRHFCSFA 2685
            ..::|....|...:|||:|...:||.|.:|.:::....:: ||..|..|...|.|||.:|||.|.
 Frog  2495 VPEQYGAQPPLEFLRQFLDLGGFYDTQTLTWKNVQDLALLAACAPPGGGRNEISPRLLKHFCLFV 2559

  Fly  2686 VNPPSQDALFHILNSILSQHMDNPIQKFDKAVIKLCENMVTTAITLHLKVVSSFLPTAIKFHYNF 2750
            :..||..||.||....|...:.:  ..|...:.|..:.:.::||.::||:.|..|||..|.||.|
 Frog  2560 LPHPSVPALQHIFQVPLGSFLQS--NNFLAEIQKCRDLLASSAIAIYLKMCSYMLPTPAKCHYTF 2622

  Fly  2751 NLRDIANIFTGVLYSNSETCPNSNQMIRLWIHECYRVYGDKLVDYTDINSFKKIVSDIVRKGI-- 2813
            ||||:..:..|:|.::.......:....|..||..||:.|:|....|...|.:.:||.:....  
 Frog  2623 NLRDLFKVLQGLLQASESVTVTRDSAALLLAHEATRVFHDRLTQAADREQFFQFLSDELHNYFKI 2687

  Fly  2814 ----EGVNDDVVYAQPLIYCHFAK-GLTDIKYMPISGWDRLKSLLDEAQDRY--------NDYIG 2865
                |.:.:|.|.     :..|.. |.|.| |.|::...:|.|.|:|.:.:.        |.|| 
 Frog  2688 SWPKEKLMEDSVQ-----FADFVDVGKTRI-YRPVTSNKKLISRLEEYRIKMKMSLVNPSNTYI- 2745

  Fly  2866 AMNLVLFDDAMSHVCRISRILESSRGYALLIGVGGSGKQSLTRLASFISSLDVFQIQLTKDYSVS 2930
                 .||:|:.|:.|.:|:.....|:.:|:|:.|:||.:...:||:|:...::::.:|:.||..
 Frog  2746 -----FFDEAVRHITRAARVFRQPGGHMMLVGLDGTGKVTSASMASYIAECQLYRLSITQTYSHG 2805

  Fly  2931 DLKANIATLYMKAGVKTSACCFLMTDSEVAREQFLVLVNDLLASGDIHELFPDDEVENIVNAVRN 2995
            |.:..:..::.:.|:...:...|:|.:::.::.||..:|.||.||::.:||..:|::.::..:::
 Frog  2806 DFREELKKVFKQTGLLGRSTVLLLTGADIVQDSFLEDLNCLLNSGEVPDLFEKEELDGLLVELQS 2870

  Fly  2996 EVKQLGIVDNRENCWKYFIEKVRSLLKVVLCFSPVGATLRVRSRKFPALVNCTTIDWFHEWPQQA 3060
            .|.:|....:.::...:|:::|:..|.|||..||||:|.|...|..|:||||.||||:.|||::|
 Frog  2871 AVPELAQSQSPQSMLSFFLQRVQYKLHVVLALSPVGSTFREHCRSHPSLVNCCTIDWYDEWPEEA 2935

  Fly  3061 LESV--SLRFLSEITVLPKELALPVSNFMAFVHKTVNDISKLYLANAKRYNYTTPKSFLELIALY 3123
            |.:|  |.....|:....:||...||.....:||:|:..:..||...:|:.|.||:::|..|..:
 Frog  2936 LLNVARSYTLQEELLQNSEELRDSVSQMCVNIHKSVSQRAAQYLRETRRHYYVTPQNYLGFINTF 3000

  Fly  3124 SKLLHEKVKANLDRRLRLENGLIKLASCTKEVDALQDVLKVQEVELKIKNQEADNLIIVVGTENE 3188
            ||:||.|.:..|..|.|...||.||......::.:|..|.....:::.|.||.:.||.....::.
 Frog  3001 SKILHSKKQNILTDRNRFFTGLSKLLGAADSIETMQQELVALGPQIEQKTQEIETLIEKAQRDSV 3065

  Fly  3189 KVSKERAFASKEEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSP 3253
            .|.:.||..::||:.:....:.|...|:...::..:..|||..|..||:.|:|.:::|:|.:..|
 Frog  3066 VVEQVRAIVAQEEEVMAAETKIVQVYAEQAVQELNEVLPALQEAVSALDALDKGDISEVKVYTHP 3130

  Fly  3254 PDAVVSVCGAVLVLFSSKGKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIKALQPYIL 3318
            |..|::|..||.||...|      ..|...:..:|: ..||..|:..||..|.......|:.|..
 Frog  3131 PFLVLTVMNAVCVLLQQK------PDWPTAKLLLGD-PGFLKRLVGLDKDSIPEKAFLKLKKYSK 3188

  Fly  3319 DAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLT 3383
            ..||:|:|:...|||...||.||:.:..::||..:|.||::.:.|::..:..|:::|......|.
 Frog  3189 TPEFNPQKVGMVSSACRSLCQWVLALEHYHDVKKMVTPKQKHVAEAQGALGLAQERLRHKQRSLA 3253

  Fly  3384 ELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQL 3448
            .:||.|..:|.:.:|:.:::|........|...:..|..||..||.|||||.|||..|...::.:
 Frog  3254 MVEEHLELMQRQSNESASERQLLAQRKQLTTERLQRAAVLISALAEEKIRWKESVDRLDLAMEGI 3318

  Fly  3449 PGDILIISCFISYVGCFTRAYRQELQEKLWMPAFKNSQPPIPSTDGVDPFEMICDDAQIAEWNNQ 3513
            .||.|:.:.||:|.|.||..||::|..: |:....:.:.|:.:...:  ...:..::::.:|.|:
 Frog  3319 IGDTLVSAAFIAYCGVFTSEYREKLVAE-WLEGCGSYRIPLSADYSI--IRAMASESEVRQWQNE 3380

  Fly  3514 GLPSDRMSAENAAILVQSERYPLMIDPQLQGIKWVKTKYGTGLVVLRLSQRNYLDQVERAVSNGS 3578
            |||.|..|.|||.::....|:||.|||..|..||:....|..|..:|.:..|||..:|.|:..|.
 Frog  3381 GLPLDPYSTENAILVKNGHRWPLFIDPHGQACKWICQMEGNELRQVRAADGNYLQVMENAMRLGE 3445

  Fly  3579 VLLIENIGENIDPVLNPLLGRQLIKKG--TVLKIGDREIDFNSRFRLILHTKLANPHYKPEMQAQ 3641
            .:|::::.|::||.|.|:||:::.::.  ..:||||.||::|..|||.:.|:..:|::.|.:...
 Frog  3446 AVLLQDVAEDLDPSLKPILGKEIFRRAGQDFIKIGDSEIEYNQHFRLYMTTQAPDPYFLPAVCIM 3510

  Fly  3642 TTLINFTVTRDGLEDQLLAEVVKVERPDLEAMRTRLTQQQNHFKITLKFLEDDLLARLSSAGDNV 3706
            .|:||||||..||.||||:.||..|:|.||..|..|.:.......||:.||:..|:.|.....::
 Frog  3511 VTMINFTVTFKGLRDQLLSSVVTHEQPHLEQQRCHLLESIAADACTLRELEEKSLSLLQKTQGHL 3575

  Fly  3707 LEDVTLVMNLEKTKKTADEIEVKVAEAKITGVQIDSAREAYRPAAERASIIYFILNDLFKINPIY 3771
            |:|..|:.||:|:|..:.::..::.::..|...|::||..|.|.|.|.:|:||::.:|.::|.:|
 Frog  3576 LDDEDLIDNLKKSKLKSKDVVKRIEDSAKTEATIEAARGTYLPVARRGAILYFVVANLIRLNYMY 3640

  Fly  3772 QFSLKAFTVVFNNAMLKAMAAEKL--------------------------------KDRVENLID 3804
            ||||:.|..||..:|..|.|...|                                |.|:.|:||
 Frog  3641 QFSLQWFHRVFVESMEAAQAPTSLVSPESIRALSRHKGTDRQTGPKEDISTDCDGRKSRINNIID 3705

  Fly  3805 SITFCSFVYTSRGLFEQDKLIFLTQLCIQILVNLGEVEPT----------ELDFLLRFPYMPNQT 3859
            ::|...:...|..||.:.:|.|...|.:.|:.|:|..||:          |.:|.|....:.|..
 Frog  3706 TLTGNVYKIVSSALFTEHQLCFSFMLTVGIMRNVGSGEPSGHSLGFLPSAEWEFFLHSRLLANTV 3770

  Fly  3860 SNFT----------------------WLTHVGWGGIRALNNQ-AVFKGLEKDIEGSHKRWKKFVD 3901
            ....                      ||:...|...:.|:.. |.|..|.:.:..|.::|..|..
 Frog  3771 GRKADSQAADVRDEIRDEDPGCHIPEWLSEPTWRQCQYLSRTLAPFAQLCQSLTSSSQQWGSFRS 3835

  Fly  3902 SE-------------------SPENEKFPGE-----WKGKSAIQRLCIMRCIRPDRMSYAMRSFI 3942
            .|                   :...|:.|.|     |:..||.|:|.:::.:.|:.:..|:|.||
 Frog  3836 REGLYGFLSESYVPSQQDGAQAANTEELPSEPVIFKWEELSAFQKLILIKVLLPEGLIRAVREFI 3900

  Fly  3943 EEKLGSKYIDARSMEFSRTFEESSPETHIFFVLSPGVDPLKDVEKLGKSLGFSFDHENFHSVSLG 4007
            .||:|.||:.:..:....|.|||:....:.|:||.|:||:..:|:|......|..|  ...||||
 Frog  3901 AEKMGMKYVQSGGVNLKETLEESNASCPLIFILSSGIDPVGQLERLALETRGSTLH--LDMVSLG 3963

  Fly  4008 QGQEIVAENAIEIASQY-GHWVILQNIHLVARWLPSLE---KKMESSLSNVHTSYRLFLSAEPAG 4068
            :||...||..|..|.:. |.||.|||.||.|.::|.|.   :|:....|.....:||:||::|  
 Frog  3964 RGQGAKAEELIHNALRLKGRWVFLQNCHLAASFMPRLSEIVEKLAQQSSTADPQFRLWLSSKP-- 4026

  Fly  4069 DPAAHILPQGILESAIKITNEPPTGMMANIHKALDN-----FSDETLEMCSKETEFKAILFSLCY 4128
            ||:   .|..||:...|:..|||.|:...:.:..|:     .::...|...:...:|.:|||||:
 Frog  4027 DPS---FPVPILQRGFKMAVEPPQGLKGKLLQTFDSSGTGAITERIFERDDRGASWKKLLFSLCF 4088

  Fly  4129 FHAVVAERRKFGPQGWNRSYPFNVGDLTISVYVLYNYLEANTRVPWEDLRYLFGEIMYGGHITDD 4193
            |:|:|.||||:|..|||..|.|...||.:||.:|...:|.:..|||:.:.||.||::|||.:||.
 Frog  4089 FNAIVNERRKYGALGWNILYEFTPSDLEVSVQMLGALMEGHNEVPWQAVHYLTGEVVYGGRVTDL 4153

  Fly  4194 WDRRLCRTYLEEFMQPELI----------------DG-ELEYCQGFPAPGILKYTGYHNYIDDNL 4241
            ||||...:.|::|..|.::                || .|..|:.              |::...
 Frog  4154 WDRRCLLSILDKFYTPAVLQEGHSFSSCKVYRSLPDGATLGECRA--------------YLESLP 4204

  Fly  4242 PSESPSLYGLHSNAEIGFLTTVSERLFRIVFELQPRMT-----GGSSGGETVSQEDIIKNI---- 4297
            .::||.::|:|.|||...|.:.::.|...|..:|.|::     .|:...|..|...||.||    
 Frog  4205 DTDSPEIFGMHPNAERANLQSQAQLLLDTVTIMQSRISVGLLPHGAGEDEAPSVLQIISNIRNAL 4269

  Fly  4298 IEDILDKTP-------TPFNI-LELMGRVED-----------------RSPYIIVAFQECERMNN 4337
            .:.:..|.|       |..|: |.|:  :.|                 .|..:.|..||.:|.|:
 Frog  4270 PQTVEGKPPEGGAAQGTDTNMTLSLL--LSDPRWETLVRATKGFDPLINSALLTVLRQETDRFNH 4332

  Fly  4338 LMTELKRSLNELDLGLKGELTISSVMEDLMVCLYMDQVPEQWTKLAYPSMLGLQSWFSDLMLRLR 4402
            |::.:..||:.|...:|||:.::..:|::.:||...:||..|.:.:|.|...|.||..||:.|:|
 Frog  4333 LLSVIHGSLHALQRAIKGEIILTKQLEEVQICLGNLKVPALWQQHSYESCKLLGSWVDDLVQRVR 4397

  Fly  4403 ELEGWV-------------------------------------ADFRMPSSIWLAGFFNPQSLLT 4430
            ....|.                                     |....|:|.||:.||.||..||
 Frog  4398 FFATWANQVVRSIMERFPQPPTKRISSRPGSSQPANSPVPISPAGMEQPTSFWLSAFFFPQGFLT 4462

  Fly  4431 AIMQQTARKNEWPLDRMCLNCDVTKKWKEELT-------------TAPREGAYINGLFMEGARWD 4482
            |::|..||.....:|.:.....|......|.|             :.|.||..:.|||::||:|:
 Frog  4463 AVLQNHARMRGLSVDSLTFQHRVQHPPAPEATVNQDIIETAFSGCSPPEEGIRVFGLFLDGAQWN 4527

  Fly  4483 MKMGTIADAFLKELFPAMPVLYI--KAVTQDKQDIKNV------YECPVYKIRLRGPT------- 4532
            .:...:.:|.....|.::|.::.  :.:|:||:...:.      |:||:|:...|..|       
 Frog  4528 GESQCLEEAGHLCRFYSLPQIHFIPRMITEDKEGGSDTESEGYQYQCPIYRTSQRAGTLSSTGLC 4592

  Fly  4533 --FVWTFNLKSRERASKWTLAGVCLLLQ 4558
              ||...:|.:...|..|...||.||.|
 Frog  4593 TNFVTAVSLPTLLPAEHWVRRGVALLCQ 4620

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kl-5NP_001015499.4 DHC_N1 197..763 CDD:285571 47/233 (20%)
DHC_N2 1368..1770 CDD:285579 107/413 (26%)
P-loop_NTPase 1903..2132 CDD:304359 139/236 (59%)
P-loop_NTPase 2217..2352 CDD:304359 67/208 (32%)
P-loop_NTPase 2510..2783 CDD:304359 91/368 (25%)
P-loop_NTPase 2860..3127 CDD:304359 84/277 (30%)
MT 3140..3480 CDD:289543 102/340 (30%)
AAA_9 3509..3722 CDD:289547 83/215 (39%)
Dynein_heavy 3864..4549 CDD:281078 232/837 (28%)
dnah14XP_017949452.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1492at2759
OrthoFinder 1 1.000 FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.