DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31819 and CG14316

DIOPT Version :8

Sequence 1:NP_723954.1 Gene:CG31819 / 260658 FlyBaseID:FBgn0028893 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_650676.2 Gene:CG14316 / 42163 FlyBaseID:FBgn0038567 Length:430 Species:Drosophila melanogaster

Alignment Length:456 Identity:127/457 (28%)
Similarity:215/457 (47%) Gaps:39/457 (9%)


  Fly    50 LTTPLESPSNN----YSSDRSLPQTKLEEGEQDVDYWELKKVFQKLDLSDQIVLYRSFRLLPAAC 110
            :|:|.:...|:    .|||        .|.|.| |...||.|.:||:::||.:|:|....:|.|.
  Fly     1 MTSPKKKDKNSNELVCSSD--------SEREND-DLAMLKIVLRKLNVNDQTLLHRHVGHIPDAL 56

  Fly   111 YTLWRSTRKRLDFRTLHKDLGEESQRHLIVHMKDHFKYVYFVADRLQENLNVLEKAGVKSIVSVQ 175
            :.|||....||:|..:.:.|........:..|......:.|.::.||:.||:||:|.:|.::.|:
  Fly    57 HMLWRLQHPRLNFELMQRKLHGSDLELFLQEMITDIPSIKFRSESLQDELNILERANIKRLLHVK 121

  Fly   176 RCELLMEEKVKSSSQQSGEDFGGNRMAQWPLHALPKLMRNLRRLTADCEIQVHFIEHFKELELLV 240
            .|.:..    |:|:.|....|     ..||..||||||.||..|...|.:|..||:.|.:||.|.
  Fly   122 CCTITW----KNSTSQKNTKF-----PHWPFLALPKLMSNLTDLDIYCPVQDCFIDQFAKLEALK 177

  Fly   241 LNGFISQTA-----LTGILERCHKLTRLFLRFDCDTLSLKLIDKCSNLRDLSLTTGLFFHQKDLV 300
            :...||:.|     |:|...:|..|:      ...|.....|..|..|.:|.:....|...::.:
  Fly   178 IAEEISKPAMDAIYLSGAPLKCLNLS------GSHTYPTSCISHCKYLSNLFVNLDTFLAGQNEI 236

  Fly   301 MKLTDLRLLELTQCETRSQLTLECMQFILNRRKDSVQLIQIDCKGFQDP-NWMKEVGLDRCSRLR 364
            :||..|..|::|:...... |.:.:..::..:.:.:..|||:|. |:|. ..:.::.|:.|..|.
  Fly   237 LKLPSLTELKITEIRENKD-TTKALANVVQTKGNELVGIQINCI-FEDHIKCLSDLTLNCCINLT 299

  Fly   365 GLVLANCYFCDREISRLLFPRVQKYIALINCPDIKDYQLIDMVRMCPGLNDIYLLDCPQLSWKVL 429
            .|.|:||.|..::|.:|..|....:....||||:.|.||:|.::....:.::.|..||:|:..:|
  Fly   300 ELQLSNCIFAYQDIVKLCLPVGITFARFTNCPDLTDEQLLDFIKANAEMEELLLDQCPELTEDLL 364

  Fly   430 QGIYRIRRSENLSYPITIILSQHSELRDAYQSMYSNFWCFKLPFLRMERVIHQCRPIRDIQFFFN 494
            .|:.::|.|.|....:.:.:::...|.|.||... .:|..|...|::|.:  :.....||...|.
  Fly   365 HGVLKVRSSGNKQVHLLLRIAKSPNLWDTYQQNL-KYWKRKESILKLESL--ESSASEDIVMHFE 426

  Fly   495 S 495
            :
  Fly   427 N 427

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31819NP_723954.1 leucine-rich repeat 236..259 CDD:275381 9/28 (32%)
leucine-rich repeat 260..305 CDD:275381 9/45 (20%)
leucine-rich repeat 306..334 CDD:275381 4/28 (14%)
leucine-rich repeat 335..362 CDD:275381 8/28 (29%)
leucine-rich repeat 363..385 CDD:275381 9/22 (41%)
leucine-rich repeat 386..412 CDD:275381 8/26 (31%)
CG14316NP_650676.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134586898
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.