DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DHRS7B and CG31937

Sequence 1:XP_005256652.2 Gene:DHRS7B HGNCID:24547 Length:372 Species:Homo sapiens
Sequence 2:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster

Alignment Length:321 Identity:95/322 (30%)
Similarity:152/322 (47%) Gaps:32/322 (10%)


Human    63 MDFITSTAILPLLFGCLGVFGLFRLLQ-----WVRGK-----AYLRNAVVVITGATSGLGKECAK 117
            |.|:....:|.:|:..:.|. |:.||.     |.:.:     :.:|..||.||||:||:|:..|.
  Fly     1 MSFLEFLLLLLVLYYVVYVL-LWILLDCNVALWYKSRFGVSLSSMRGQVVWITGASSGIGRALAL 64

Human   118 VFYAAGAKLVLCGRNGGALEELIRELTASHATKVQTHKPYLVTFDLTDSGAIVAAAAEILQCFGY 182
            .....|.||||..|....||::..|..|:....:.|....::..|:.|..........:|..|..
  Fly    65 SLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNHFHR 129

Human   183 VDILVNNAGISYRGTIMDTTVDVDKRVMETNYFGPVALTKALLPSMIKRR--QGHIVAISSIQGK 245
            :|:||||||.|.|.:..:..::||:.:.|.:.|..|.|::.::...:::.  :|||.|.|||.|.
  Fly   130 LDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIAGF 194

Human   246 MSIPFRSAYAASKHATQAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTT 310
            ..:||...|.|:|||..|:...|:.||.  :::|::.:||.|.|:....|.|  ||:.|.:..:|
  Fly   195 SPVPFSPTYCAAKHALNAYLLSLKVEMR--KLDVSLFAPGPIATDFLQEAFT--GSQGGKVGLST 255

Human   311 A-QGRSPVEVAQDVLAAVGKKKKDVILADLLPSLAVYLRTLAPGLFFSLMASRARKERKSK 370
            | |.|...:...|:.|.....|.|:....|.|              .:|:|..||....||
  Fly   256 ANQKRMTAQRCGDLFAVALANKMDLTWCGLFP--------------VNLLAYCARNPTLSK 302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DHRS7BXP_005256652.2 11beta-HSD1_like_SDR_c 97..358 CDD:187593 80/264 (30%)
PRK06181 99..368 CDD:235726 83/272 (31%)
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 82/267 (31%)
adh_short 47..245 CDD:278532 66/202 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D429842at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.