DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GALNS and CG7402

Sequence 1:XP_011521284.1 Gene:GALNS HGNCID:4122 Length:581 Species:Homo sapiens
Sequence 2:NP_649023.1 Gene:CG7402 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster

Alignment Length:543 Identity:152/544 (28%)
Similarity:226/544 (42%) Gaps:126/544 (23%)


Human    46 EMGWGDLGVYGEPSRETPNLDRMAAEGLLFPNFYSANPLCSPSRAALLTGRLPIRNGFYTTNAHA 110
            :||..|:..:|.....|||:|.:|..|:|....|..| ||:||||.||||:.||..|.       
  Fly    37 DMGMNDVSFHGSNQILTPNIDALAYNGILLNKHYVPN-LCTPSRATLLTGKYPIHTGM------- 93

Human   111 RNAYTPQEIV------GGIPDSEQLLPELLKKAGYVSKIVGKWHLGH-RPQFHPLKHGFDEWFGS 168
                  |..|      .|:|..|:|:||:.:.|||.:.:|||||||. |....|...|||..||.
  Fly    94 ------QHFVIITDEPWGLPQRERLMPEIFRDAGYSTHLVGKWHLGFWRKDLTPTMRGFDHHFGY 152

Human   169 PNCHFGPYDNKARPNIPVYRDWEMVGRYYE---EFPINLK-TGEAN---LTQIYLQEALDFIKRQ 226
            .|.:...||::.|          |:.|.|.   :|..:|: ..|||   .|:.:..||...|::.
  Fly   153 YNGYIDYYDHQVR----------MLDRNYSAGLDFRRDLEPCPEANGTYATEAFTSEAKRIIEQH 207

Human   227 ARHHPFFLYWAVDATH-----APVYASK------PFLGTSQRGRYGDAVREIDDSIGKILELLQD 280
            .:..|.|:..:..|.|     :|:.|.:      |.:...:|..|...:..:|.|:.:.:..|:|
  Fly   208 DKSKPLFMVLSHLAVHTGNEDSPMQAPEEEVAKFPHIRDPKRRTYAGMISSLDKSVAQTIGALKD 272

Human   281 LHVADNTFVFFTSDNGAALISAPEQGGSNGPFLCGKQTTFEGGMREPALAWWPGHVTAGQVSHQL 345
            ..:.:|:.:...|||||..|......|||.|:...|::.:|||:|.....|.|.....|.||:|.
  Fly   273 NGMLNNSIILLYSDNGAPTIGIHSNAGSNYPYRGQKESPWEGGIRSAGALWSPLLKERGYVSNQA 337

Human   346 GSIMDLFTTSLALAGLTPPSDRAIDGLNLLPTLLQG----------RLMDRPIFY--YRGDTLMA 398
            ...:|...|....||::.|.|..:||:||.| :|.|          .::|....|  |..|||..
  Fly   338 IHAVDWLPTLAGAAGVSLPQDLPLDGINLWP-MLSGNEEPKPRTMIHVLDEVFGYSSYMRDTLKY 401

Human   399 ATLGQHKAHFWTW-----TNS----WENFRQGI---------------------------DFCP- 426
            ......|..:..|     ||.    .|::.|.:                           :.|| 
  Fly   402 VNGSSFKGRYDQWLGELETNEDDPLGESYEQHVLASDVQSLLGNRGLTKDRIRQMRSEATETCPP 466

Human   427 --GQNVSGVTTHNLEDH-----TKLPLIFHLGRDPGERFPLSFASAEYQEALSRITSVVQQHQEA 484
              |||       .||.|     .|.|..|.|.:||.||:.|   :..|...|.::...::|.::.
  Fly   467 IEGQN-------PLESHFKCEPLKAPCFFDLAKDPCERYNL---AQMYPLQLQQLADELEQIRKT 521

Human   485 LVP----------AQPQLNVCNW 497
            .:|          |.|..:..||
  Fly   522 AIPSARVPHSDSRANPTFHNGNW 544

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GALNSXP_011521284.1 GALNS 46..500 CDD:293776 152/544 (28%)
AslA 46..489 CDD:225661 149/534 (28%)
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 127/447 (28%)
4-S 28..436 CDD:293753 127/424 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87939205
eggNOG 1 0.900 E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.