DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DNAJB5 and CG5001

Sequence 1:NP_001128476.2 Gene:DNAJB5 HGNCID:14887 Length:462 Species:Homo sapiens
Sequence 2:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster

Alignment Length:361 Identity:192/362 (53%)
Similarity:249/362 (69%) Gaps:27/362 (7%)


Human   115 MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRGLYD 179
            ||||||||||:|..|.:|||||||||:||:|||||||..|||:||||:||||:||||..||.:||
  Fly     1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYD 65

Human   180 QYGEEGLKTGGGTSGG-SSGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDM 243
            :|||:|||:||..:|| ||.||.|.|||||.||||.|||.||||..||....:.     ||....
  Fly    66 KYGEDGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNL-----FDKKVF 125

Human   244 DVDEDED----PFGAFGRFGFNGLSRGPR----------RAPEPLYPRRKVQDPPVVHELRVSLE 294
            |:|.:.|    |||..|  ..:||..|.|          ..|   :.:.:.|||||.|:|.|:||
  Fly   126 DLDTEPDFFSSPFGGIG--SRHGLGSGFRPSFRSHSFNVHTP---FKKEQKQDPPVEHDLYVTLE 185

Human   295 EIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFV 359
            |||||..|:|||:||.:..||.: |.|:|.|.|.||.|||.|||:||.||||..|..|||||||:
  Fly   186 EIYHGCVKKMKISRRIVQADGSS-RKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFI 249

Human   360 LKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTIDGRVIPL-PCNDVIKPGTVKRLRGEGL 423
            ::|||||.|:|:|:::.|:|.::||:||||....:||:.|..:.: ...::|||.||||::|.||
  Fly   250 IRDKPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGL 314

Human   424 PFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHL 459
            ||||..|::|||:|.|.::||::||...:::||..|
  Fly   315 PFPKDTTRKGDLLVAFDIQFPEKLTAAQKEVLKDML 350

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DNAJB5NP_001128476.2 DnaJ 114..457 CDD:223560 191/358 (53%)
DnaJ 118..179 CDD:278647 45/61 (74%)
DnaJ_C 283..447 CDD:199909 89/165 (54%)
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 190/357 (53%)
DnaJ 4..65 CDD:278647 45/61 (74%)
DnaJ_C 174..338 CDD:199909 89/165 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116977740
eggNOG 1 0.900 E1_COG0484
Hieranoid 1 1.000
Homologene 1 1.000 H8176
Inparanoid 1 1.050 371 1.000 Inparanoid score I2100
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1393097at2759
OrthoFinder 1 1.000 FOG0000281
OrthoInspector 1 1.000 T130177
orthoMCL 1 0.900 OOG5_126773
Panther 1 1.100 LDO PTHR24078
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1020
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.