DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ARIH1 and ari-2

Sequence 1:NP_005735.2 Gene:ARIH1 HGNCID:689 Length:557 Species:Homo sapiens
Sequence 2:NP_477374.1 Gene:ari-2 FlyBaseID:FBgn0025186 Length:509 Species:Drosophila melanogaster

Alignment Length:567 Identity:179/568 (32%)
Similarity:284/568 (50%) Gaps:91/568 (16%)


Human     1 MDSDEGYNYEFDEDEECSEEDSGAEEEEDEDDDEPDDDTLDLGEVELVEPGLGVGGERDGLLCGE 65
            ||||    .|.|     .|.|:..|.::|.|.....:|.    :||.::                
  Fly     1 MDSD----IEMD-----MESDNDGEYDDDYDYYNTGEDC----DVERLD---------------- 36

Human    66 TGGGGGSALGPGGGGGGGGGGGGGGPGHEQEEDYRYEVLTAEQILQHMVECIREVNEVIQNPATI 130
                                     |.....|.:.||.||.|.|.:.:.|.:.::|.::|...::
  Fly    37 -------------------------PKRADPEYFEYECLTVEDIEKLLNERVEKLNTILQITPSL 76

Human   131 TRILLSHFNWDKEKLMERY-FDGNLEKLFAECHVINPSKKSRTRQMNTRSSA------------- 181
            .::||....|:...::|:| .|.|...:.|.   |.|...:.|...:|.::|             
  Fly    77 AKVLLLEHQWNNVAVVEKYRQDANALLVTAR---IKPPSVAVTDTASTSAAAASAQLLRLGSSGY 138

Human   182 ----------QDMPCQICYLNYPNSYFTGLECGHKFCMQCWSEYLTTKIMEEGMGQTISCPAHGC 236
                      :...|.:|..:.....|..|.|||.||..||:.|..|:|. :|:...|.|.|..|
  Fly   139 KTTASATPQYRSQMCPVCASSQLGDKFYSLACGHSFCKDCWTIYFETQIF-QGISTQIGCMAQMC 202

Human   237 DILVDDNTVMRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPDCHHVVKVQYPDAKPVRCK-CG 300
            ::.|.::.|:.|:|...::.|||......:|:.:..|::||.|:|..:|:.....||...|| |.
  Fly   203 NVRVPEDLVLTLVTRPVMRDKYQQFAFKDYVKSHPELRFCPGPNCQIIVQSSEISAKRAICKACH 267

Human   301 RQFCFNCGENWHDPVKCKWLKKWIKKCDDDSETSNWIAANTKECPKCHVTIEKDGGCNHMVCRNQ 365
            ..|||.||.::|.|..|:.:|||:.||.|||||:|:|:|:||:|||||:.|||:||||||.|  .
  Fly   268 TGFCFRCGMDYHAPTDCQVIKKWLTKCADDSETANYISAHTKDCPKCHICIEKNGGCNHMQC--F 330

Human   366 NCKAEFCWVCLGPWEPHGSAWYNCNRYNEDDAKAARDAQERSRAALQRYLFYCNRYMNHMQSLRF 430
            |||.:|||:|||.|:.|||.:|.|:||.::...|......::|.||::||.|..|:.||.:||:.
  Fly   331 NCKHDFCWMCLGDWKTHGSEYYECSRYKDNPNIANESVHVQAREALKKYLHYYERWENHSKSLKL 395

Human   431 EHKLYAQVKQKM-EEMQQHNMSWIEVQFLKKAVDVLCQCRATLMYTYVFAFYLKKNNQSIIFENN 494
            |.:...:::|:: .::...:.:||:.|:|..|..:|.:||.||.|||.:|:|::..::..:||..
  Fly   396 EQQTIDRLRQRINSKVMNGSGTWIDWQYLFNAAALLAKCRYTLQYTYPYAYYMEAGSRKNLFEYQ 460

Human   495 QADLENATEVLSGYLERDISQDSLQDIKQKVQDKYRYCESRRRVLLQ 541
            ||.||...|.||..:||..:.| |.|::.::.    ..|.||..||:
  Fly   461 QAQLEAEIENLSWKIERAETTD-LGDLENQMD----IAEKRRTTLLK 502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ARIH1NP_005735.2 UBA-like. {ECO:0000305|PubMed:23707686} 105..153 12/49 (24%)
TRIAD supradomain. {ECO:0000255|PROSITE-ProRule:PRU01221} 182..393 93/212 (44%)
RING-HC_RBR_HHARI 185..242 CDD:319540 20/57 (35%)
RING-HC finger (C3HC4-type) 186..236 CDD:319540 18/50 (36%)
IBR 257..317 CDD:214763 22/61 (36%)
IBR <339..379 CDD:307574 27/40 (68%)
Ariadne domain. {ECO:0000305|PubMed:23707686} 408..557 47/136 (35%)
ari-2NP_477374.1 IBR 222..284 CDD:214763 22/62 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D429758at33208
OrthoFinder 1 1.000 FOG0000641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126891
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.