DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Chrng and nAChRbeta1

Sequence 1:NP_062018.1 Gene:Chrng RGDID:2354 Length:519 Species:Rattus norvegicus
Sequence 2:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster

Alignment Length:520 Identity:176/521 (34%)
Similarity:273/521 (52%) Gaps:62/521 (12%)


  Rat    10 LLLLLATCLGAQSRNQEERLLADLMRNYDPHLRPAERDSDVVNVSLKLTLTNLISLNEREEALTT 74
            :|:|:|..|.:.|.: ||||:.||.|.|:..:||.:..:..|.|...|....||::||:.:.:.:
  Fly    13 ILVLVAFSLVSASED-EERLVRDLFRGYNKLIRPVQNMTQKVGVRFGLAFVQLINVNEKNQIMKS 76

  Rat    75 NVWIEMQWCDYRLRWDPKDYEGLWILRVPSTMVWQPDIVLGNNVDGVFEVALYCNVLVSPDGCIY 139
            |||:.:.|.||:|:||..||.|:.:||:|...||:|||||.||.||.:||....|||:.|.|.:.
  Fly    77 NVWLRLVWYDYQLQWDEADYGGIGVLRLPPDKVWKPDIVLFNNADGNYEVRYKSNVLIYPTGEVL 141

  Rat   140 WLPPAIFRSSCSISVTYFPFDWQNCSLVFQSQTYSTSEINLQLSQEDGQAIEWIFIDPEAFTENG 204
            |:||||::|||:|.|||||||.|.|.:.|.|.|::..:::|.|.....      |:|...:.::|
  Fly   142 WVPPAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFNGDQVSLALYNNKN------FVDLSDYWKSG 200

  Rat   205 EWAIRHRPAKMLL---DPVTPAEEAGHQKVVFYLLIQRKPLFYVINIIVPCVLISSVAILIYFLP 266
            .|.|...||.:.:   |...|.|    ..:.||::|:||.|||.:|:|:|.||||.:.:|:::||
  Fly   201 TWDIIEVPAYLNVYEGDSNHPTE----TDITFYIIIRRKTLFYTVNLILPTVLISFLCVLVFYLP 261

  Rat   267 AKAGGQKCTVATNVLLAQTVFLFLVAKKVPETSQAVPLISKYLTFLMVVTILIVVNSVVVLNVSL 331
            |:| |:|.|:..::||:..|||.||:|.:|.||..:|||:|||.|..::..:.::.:|:::|.:.
  Fly   262 AEA-GEKVTLGISILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIMNTVSILVTVIIINWNF 325

  Rat   332 RSPHTHSMARGVRKVFLRLLPQLLRM---------------------HVHPR--APAAVQDARLR 373
            |.|.||.|...:|.:||..||..|.|                     |.||.  :||.: ...:.
  Fly   326 RGPRTHRMPMYIRSIFLHYLPAFLFMKRPRKTRLRWMMEMPGMSMPAHPHPSYGSPAEL-PKHIS 389

  Rat   374 LQNGSSSGWPIMTREEGDLCLPRSELLFRQRQRNGLVQAVLEKLENGPEM------RQSQEFCGS 432
            ...|..|...:|  |..||..|..:              :..|:.:|.|:      |:..|...|
  Fly   390 AIGGKQSKMEVM--ELSDLHHPNCK--------------INRKVNSGGELGLGDGCRRESESSDS 438

  Rat   433 LKQASPAIQACVDACNLMARARHQQSHFDSGNEEWLLVGRVLDRVCFLAMLSLFICGTAGIFLMA 497
            : ..||......:|...:|.....:..:....|:|..|..|:||:.......:...||.||.:.|
  Fly   439 I-LLSPEASKATEAVEFIAEHLRNEDLYIQTREDWKYVAMVIDRLQLYIFFIVTTAGTVGILMDA 502

  Rat   498  497
              Fly   503  502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ChrngNP_062018.1 LIC 23..497 CDD:273305 170/506 (34%)
Neur_chan_LBD 26..241 CDD:280998 88/218 (40%)
Neur_chan_memb 248..494 CDD:280999 78/275 (28%)
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 175/517 (34%)
Neur_chan_LBD 28..236 CDD:280998 88/218 (40%)
Neur_chan_memb 243..498 CDD:280999 77/274 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 1 0.910 0.787 Consistency score
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.