DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Chrna4 and nAChRbeta1

Sequence 1:NP_077330.1 Gene:Chrna4 RGDID:2346 Length:630 Species:Rattus norvegicus
Sequence 2:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster

Alignment Length:616 Identity:242/617 (39%)
Similarity:334/617 (54%) Gaps:130/617 (21%)


  Rat    13 LLLPLLLLLGTGLLPASSHIETRAHAEERLLKRLFSGYNKWSRPVGNISDVVLVRFGLSIAQLID 77
            ||..:|:|:...|:.||..       ||||::.||.||||..|||.|::..|.|||||:..|||:
  Fly     9 LLCSILVLVAFSLVSASED-------EERLVRDLFRGYNKLIRPVQNMTQKVGVRFGLAFVQLIN 66

  Rat    78 VDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTK 142
            |:||||:|.:|||::..|:||:|:||..||..:..:|:|.:.:|:|||||:|||||::.|.:.:.
  Fly    67 VNEKNQIMKSNVWLRLVWYDYQLQWDEADYGGIGVLRLPPDKVWKPDIVLFNNADGNYEVRYKSN 131

  Rat   143 AHLFYDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVSIHSR--VDQLDF 205
            ..::..|.|.|.|||||:|||:||||:||||||.|.|||||||::..::.|...:::  ||..|:
  Fly   132 VLIYPTGEVLWVPPAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFNGDQVSLALYNNKNFVDLSDY 196

  Rat   206 WESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFIIRRLPLFYTINLIIPCLLISCLTVLVFYLP 270
            |:||.|.|::.....|..:.:.......|||:..||||..||||:|||:|.:|||.|.|||||||
  Fly   197 WKSGTWDIIEVPAYLNVYEGDSNHPTETDITFYIIIRRKTLFYTVNLILPTVLISFLCVLVFYLP 261

  Rat   271 SECGEKVTLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHR 335
            :|.||||||.||:||||.|||||:::|:|.||||:|||.:|||||.|..|:||::||.::|.:.|
  Fly   262 AEAGEKVTLGISILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIMNTVSILVTVIIINWNFR 326

  Rat   336 SPRTHTMPAWVRRVFLDIVPRLLFMKRPSVVKDNCRRLIESMHKMANAPRFWPEPVGEPGILSDI 400
            .||||.||.::|.:||..:|..||||||.  |...|.::|                         
  Fly   327 GPRTHRMPMYIRSIFLHYLPAFLFMKRPR--KTRLRWMME------------------------- 364

  Rat   401 CNQGLSPAPTFCNPTDTAVETQPTCRSPPLEVPDLKTSEVEKASPCPSPGS-CPPPKSSS---GA 461
                                      .|.:.:|         |.|.||.|| ...||..|   |.
  Fly   365 --------------------------MPGMSMP---------AHPHPSYGSPAELPKHISAIGGK 394

  Rat   462 PMLIKARSLSVQHVPSSQEAAEDGIRCRSRSIQYCVSQDGAASLADSKPTSSPTSLKARPSQLPV 526
            ...::...||..|.|:          |:   |...|:..|...|.|.                  
  Fly   395 QSKMEVMELSDLHHPN----------CK---INRKVNSGGELGLGDG------------------ 428

  Rat   527 SDQASPCKCTCKEPSPVSPVTVLKAGGTKAPPQHLPLSPALTRAVEGVQYIADHLKAEDTDFSVK 591
                      |:..|..|              ..:.|||..::|.|.|::||:||:.||.....:
  Fly   429 ----------CRRESESS--------------DSILLSPEASKATEAVEFIAEHLRNEDLYIQTR 469

  Rat   592 EDWKYVAMVIDRIFLWMFIIVCLLGTVGLFL 622
            ||||||||||||:.|::|.||...||||:.:
  Fly   470 EDWKYVAMVIDRLQLYIFFIVTTAGTVGILM 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Chrna4NP_077330.1 Neur_chan_LBD 39..245 CDD:280998 100/208 (48%)
Neur_chan_memb 252..621 CDD:280999 130/373 (35%)
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 242/615 (39%)
Neur_chan_LBD 28..236 CDD:280998 100/208 (48%)
Neur_chan_memb 243..498 CDD:280999 130/372 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H592
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D188416at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 1 0.910 0.787 Consistency score
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.