DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Snai2 and wor

Sequence 1:NP_037167.1 Gene:Snai2 RGDID:3722 Length:268 Species:Rattus norvegicus
Sequence 2:NP_476601.1 Gene:wor FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster

Alignment Length:142 Identity:108/143 (76%)
Similarity:120/143 (84%) Gaps:4/143 (3%)


  Rat   127 KFQCNLCNKTYSTFSGLAKHKQLHCDA----QARKSFSCKYCDKEYVSLGALKMHIRTHTLPCVC 187
            ::.|..|.|:|||:|||:||:|.||.:    |.:|.||||.|||.||||||||||||||||||.|
  Fly   344 RYHCQDCGKSYSTYSGLSKHQQFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTHTLPCKC 408

  Rat   188 KICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSR 252
            .|||||||||||||||||||||||||||.|||||||||||||||:|||||||||.|..|:|:|||
  Fly   409 PICGKAFSRPWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAHMQTHSDVKKYSCPTCTKSFSR 473

  Rat   253 MSLLHKHEESGC 264
            ||||.||.:|||
  Fly   474 MSLLAKHLQSGC 485

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Snai2NP_037167.1 zf-C2H2 213..235 CDD:278523 20/22 (91%)
C2H2 Zn finger 215..235 CDD:275368 18/20 (90%)
zf-H2C2_2 227..252 CDD:290200 19/25 (76%)
C2H2 Zn finger 243..259 CDD:275368 11/16 (69%)
SNAG domain. {ECO:0000250} 1..20
C2H2 Zn finger 130..150 CDD:275370 12/20 (60%)
C2H2 Zn finger 161..181 CDD:275368 18/20 (90%)
C2H2 Zn finger 187..207 CDD:275368 19/20 (95%)
zf-H2C2_2 200..223 CDD:290200 22/23 (96%)
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368
C2H2 Zn finger 317..334 CDD:275368
zf-C2H2 345..367 CDD:278523 12/22 (55%)
C2H2 Zn finger 347..367 CDD:275368 12/20 (60%)
PHA00732 379..>417 CDD:177300 33/38 (87%)
C2H2 Zn finger 382..402 CDD:275368 18/20 (90%)
zf-C2H2_8 405..482 CDD:292531 66/77 (86%)
zf-C2H2 406..428 CDD:278523 20/22 (91%)
C2H2 Zn finger 408..428 CDD:275368 19/20 (95%)
zf-H2C2_2 421..444 CDD:290200 22/23 (96%)
zf-C2H2 434..456 CDD:278523 20/22 (91%)
C2H2 Zn finger 436..456 CDD:275368 18/20 (90%)
zf-H2C2_2 448..473 CDD:290200 19/25 (76%)
C2H2 Zn finger 464..481 CDD:275368 12/17 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2462
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T131167
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.