DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GABPA and Ets96B

Sequence 1:NP_001184226.1 Gene:GABPA HGNCID:4071 Length:454 Species:Homo sapiens
Sequence 2:NP_996290.1 Gene:Ets96B FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster

Alignment Length:152 Identity:61/153 (40%)
Similarity:92/153 (60%) Gaps:15/153 (10%)


Human   274 ASVQSATPTTIK--VINSSAKAAKVQRAPRISGEDRSSPGNRTGNNGQ--------IQLWQFLLE 328
            |::.|..|:.::  |::|:..:....|..:.    .:|.|..|.:|||        :||||||:.
  Fly   446 AAISSTYPSALRPNVVDSTTSSDAELRLDQF----YASNGISTSSNGQAISQRRGSLQLWQFLVA 506

Human   329 LLTD-KDARDCISWVGDEGEFKLNQPELVAQKWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQG 392
            ||.: ..:..||:|.|...||||.:||.||::||.:||:|.|||:||||:|||||:..::.||.|
  Fly   507 LLDEPTTSASCIAWTGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIMQKVNG 571

Human   393 KRFVYKFVCDLKTLIGYSAAEL 414
            :|:||:||||...|...:...|
  Fly   572 ERYVYRFVCDPDALFNMAYGHL 593

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GABPANP_001184226.1 GABP-alpha 40..119 CDD:314490
SAM_PNT-GABP-alpha 168..254 CDD:176084
ETS 319..403 CDD:197710 48/93 (52%)
Ets96BNP_996290.1 ETS 497..583 CDD:197710 47/86 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.