DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SPAC4F10.16c and CG33298

Sequence 1:NP_594759.1 Gene:SPAC4F10.16c PomBaseID:SPAC4F10.16c Length:1367 Species:Schizosaccharomyces pombe
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1513 Identity:430/1514 (28%)
Similarity:662/1514 (44%) Gaps:358/1514 (24%)


pombe    13 LKSSLHGLSICAFNHLHHVPQHNGSLA-----HEGPTNQTDYSSRHHESQFSQEAHAEQRSRDDE 72
            :||::.|.. .||:.........||.|     |....::||:        .....|.|:.:|:..
  Fly   120 IKSAMKGHQ-RAFSQGQITDSPPGSAAPAGRGHSRVGSKTDF--------ILPPGHKEEPAREPS 175

pombe    73 EANSFEGSCNNSDQSWTSR--VTSKKNEA----------GTESGDASVRRIYVTSIPEE------ 119
            ...|..|...:|.|:..|.  .|.::.||          ...:||....|.|.|.:|..      
  Fly   176 APTSATGGRGHSRQASRSESIYTLRRTEAPPWWKRLTLCNYNTGDKFEERSYRTVVPNHTVPPKT 240

pombe   120 -HRHLPSQWFPSNKIRTTKYTPVSFIPKNLWNQFKNIANAFFLFVTLLQCIPLFCPEHLGLSFIP 183
             .|..|:..|..|||||||||.:|||||||..||..:||.:|:|:.||..:|........::.||
  Fly   241 PKRDHPNGQFVGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEVAMIP 305

pombe   184 LSVILLTTAIKDGIEDYRRCVLDKKFNNTLTWKLVGFNNANALGEHIGLWRKLKKFISHTVADMS 248
            :..:|..||:||..||.||...||:.|||.                                   
  Fly   306 VLFVLGVTAVKDLFEDRRRRASDKRINNTT----------------------------------- 335

pombe   249 YCLKNSGISSGLATLTVDNISHRHSLESDSAFTLSSVSQDSLEIHEIGNSGPSNSFSVIQEQSTG 313
             |....|                                                          
  Fly   336 -CRVYDG---------------------------------------------------------- 341

pombe   314 SSNAKFERVCRKSLLVGDIVKVLADEAIPADLLILSTENSNGVCYVETKNLDGETNLKDKYALCS 378
             ...::::|..:.|.|||||.:..:|.:|||:|:|.|.:..||||::|.:||||||||.:..:..
  Fly   342 -ETERYKKVKWQELRVGDIVHLSNNETVPADILLLRTSDPQGVCYIDTCDLDGETNLKRREVVRG 405

pombe   379 TKCCKSEYRCSAASFWVECEQPHADLYSLNGVVKAPGAVQSPSESTNGRKIHEEPFSISNVLLCG 443
            .:..:|.:..|.....||.:.|...||..:|.:..|          .|.::   |.|...:||..
  Fly   406 FEEMQSIFVPSKFVSRVEADAPTTKLYRFHGALIHP----------TGERV---PISTECLLLRE 457

pombe   444 CTLRNSKWVIGLVLYTGSETRIQKNRGLTPSKRSRITRDLNWTIILNFLLLFAMCLFSGVLRSIY 508
            ..|:|:.::.|:|:|.|.||:...|......|||::.:.:|..:|...::|..:|:...:...::
  Fly   458 SRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMNIDVIWCVIILLILCVVGAIGCRMW 522

pombe   509 SAQNNSARVFELSKNSNTAPAHGIISIFTSLILFQNLVPISLYITMDIVRSIQSYFIFSDREMYD 573
            .:......|..|..|..||....:...:|.:::.|.::|:|||:|:::.:.:|.:.|.::.:::|
  Fly   523 LSSFTHFPVPYLPPNKLTANMESMWIFWTYIVILQVMIPLSLYVTIELCKILQVFHIHNNVDLFD 587

pombe   574 EKLDCPCSPKSWNISDDLGQIEYIFSDKTGTLTQNIMSFKKCSINGIRYGKSHNEDTCIKKR--- 635
            .:.:.....::.||:::||||::||:|||||||:|.|.|::|.:||..|....:|...|..:   
  Fly   588 AETNKQTECRAMNITEELGQIQHIFTDKTGTLTENKMIFRRCVVNGSDYNHPPSELEKIYSKPGA 652

pombe   636 --------RNLNY---------------------------------------------------- 640
                    .|||.                                                    
  Fly   653 PAPPLIPNDNLNSDMAQLTQGTYLTPHAQRIQEFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQ 717

pombe   641 --NENLSCKVDLDKKKML----------------------------------ETLSLSDSPNPE- 668
              |...:.|....::|:|                                  |:.|::.||.|. 
  Fly   718 IGNSPANLKHGKQRQKLLASSTSTTTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNL 782

pombe   669 -----------SITFISSKFVDHLQSN--------ENYIQTEACFEFFKALALCHSVVTDV---- 710
                       :::.|||.......|.        :|...:.:.....:|.|:.:|.:|.:    
  Fly   783 LFALPAQSHQPTLSPISSSAESSPNSESESPSPPMKNKSLSNSISPTGRAKAVINSKITSIATFL 847

pombe   711 ----------------------QDETLIYNAQSPDEEALVKVARDFGFTLLNTKNRRYTIR--IR 751
                                  .|...:|.|:||||.|||..|..:...|||....:..:.  :.
  Fly   848 NAKTQGKRMKLPSSKTGTIYRTADGRPLYEAESPDELALVNAAYSYDCCLLNRSPNQILVSMPMA 912

pombe   752 GENKNFRVLDIIPFTSTRKRMSVIIRD--EDGIIHLICKGADTVIFPRL-----SSGQNNIIEKT 809
            |..:.:.:|.::||.|:||.||:::|.  ...|: |..||||:.|.|.|     :|.:..:.|:|
  Fly   913 GATREYEILKVLPFDSSRKCMSIVVRQIGSQEIV-LYTKGADSSIMPVLVPCSHNSPEGILREQT 976

pombe   810 KKHLASFSSEGFRTLCIARRTIDKQDYLEWKVNFNEANSAIHERNEKVSKVSEMIEQELELLGGT 874
            ::.|..::.||.|.|.:|:||::..||.:|.....|...::..|..::......:|..|.|||.|
  Fly   977 QQLLDRYAREGLRILVMAKRTLNSADYTDWWARHQEIEMSLENRERRLRDSFAKLESNLTLLGAT 1041

pombe   875 AIEDKLQENVPETIALLAIAGIKLWVLTGDKVETAINIGYSCNLLDPNMTIFRIDANSFGALEEV 939
            .|||:||:.||||||.|..|||.:|||||||.||||||.||..|....|.:.|:.|.|..|.|  
  Fly  1042 GIEDRLQDGVPETIASLLSAGISVWVLTGDKPETAINIAYSAKLFTQQMELIRLTARSRDAAE-- 1104

pombe   940 EAFIRNTLCFNFGYMGTDEEFRFLLKDHSPPSPKHAIVIDGDALNFVLSEQVSFL--FLMLCKQC 1002
                 ..:.|....|..|:....|....|....:.|:|:||..|.|:|..:...:  ||.|.|:|
  Fly  1105 -----TAINFYLTDMENDKTTSTLGYGQSLRKKQRALVVDGKTLTFILDPKSKLILPFLRLSKRC 1164

pombe  1003 KTVLCCRVSPSQKAAVVALVKKSLNVVTLAIGDGANDVSMIQEADVGVGIKGVEGQAASMSADYA 1067
            .:|||||.:|.|||.:|.:||:.||:.|||||||||||||||.|||||||.|.||..|.|:||:.
  Fly  1165 ASVLCCRSTPLQKAYLVKVVKEELNLRTLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAADFT 1229

pombe  1068 IGQFSFLGRLLLVHGRWDYKRMSQMISFFFYKNVIWTFILFWYQFYNEFDGNYIFDYTYVMLFNL 1132
            :.:|.:|.||||.||.|.|.|:|:||.:|||||..:.|::||||.|..|.|..:.|..|:||:||
  Fly  1230 LPRFRYLERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNL 1294

pombe  1133 LFTSLPVIIAGCFDQDVDASVSMKNPSLYQRGILGLEWNGKRFWSYMLDGIYQSLVCFGVALFVF 1197
            :|||||.:..|.:|:.|...:.:|||.||:.|.||:.:....||..:||.:|||||.|.|||..:
  Fly  1295 IFTSLPPLAIGVYDKRVAEDLLLKNPYLYKNGRLGVAYRPHDFWLILLDALYQSLVIFFVALCAY 1359

pombe  1198 KFGDFVSWTGRNIECIEDIGLFISSPTIFVINIFILMNQERLNLISLITWMFSIGVFWIWTFIYS 1262
            ...|...|         :.|..|::..:|...:...:......::.:::.:.|:|.|:::..:|.
  Fly  1360 AESDVGIW---------EFGTTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGSFYLFAIVYD 1415

pombe  1263 EVGPSYAFHKSASRTCQT-FG----------------FWCVTVLTIALCLLPRFSYICLQKLFYP 1310
            .|             |.. ||                .|.|.:|:..:.:|||..          
  Fly  1416 SV-------------CMNCFGVRSSYWVIFVCFASAVHWLVIMLSTVVAVLPRLL---------- 1457

pombe  1311 RDIDLLRRRLCAKSDDET 1328
              :..:|..||  .||.|
  Fly  1458 --LTTVRISLC--PDDST 1471

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SPAC4F10.16cNP_594759.1 ATPase-Plipid 128..1318 CDD:273734 395/1363 (29%)
PhoLip_ATPase_N <128..174 CDD:292826 26/46 (57%)
Cation_ATPase 702..800 CDD:289987 35/133 (26%)
R3H 854..913 CDD:294210 34/59 (58%)
HAD_like <1013..1050 CDD:304363 27/37 (73%)
PhoLip_ATPase_C 1061..1310 CDD:292829 84/266 (32%)
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 26/50 (52%)
ATPase-Plipid 250..1473 CDD:273734 400/1375 (29%)
E1-E2_ATPase 302..>394 CDD:278548 40/187 (21%)
Cation_ATPase <880..965 CDD:289987 30/86 (35%)
HAD_like <1177..1240 CDD:304363 40/63 (63%)
PhoLip_ATPase_C 1223..1468 CDD:292829 87/281 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H68636
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.870

Return to query results.
Submit another query.