DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SPAC17C9.16c and CG33282

Sequence 1:NP_001342868.1 Gene:SPAC17C9.16c PomBaseID:SPAC17C9.16c Length:531 Species:Schizosaccharomyces pombe
Sequence 2:NP_001097067.1 Gene:CG33282 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster

Alignment Length:467 Identity:90/468 (19%)
Similarity:151/468 (32%) Gaps:148/468 (32%)


pombe    82 KLVVTFDVCFLTFAVYMGSAIFTPGIQEIR----------ETMHVGTVPVILGLTLFVEGYAVGP 136
            :|:.|..|..:||...:|....:|.:.:|:          ....:..:..:|||........:..
  Fly    17 QLLATVIVNIITFGHGVGVGWLSPTLTKIQTADSPLDFEVNLAQISWLGSMLGLDSLCGNLTIAM 81

pombe   137 LIFSPLSEVPQIGRQKIYVLSLIVFICLQIPTALGSSLGVLLPMRFLAGVFGSPALSTGGASLAD 201
            ||       .:.||:....|....:.|:.|.....|::..|...|||.|.       ||||... 
  Fly    82 LI-------ERAGRKFCLYLMAGPYACIWILIYCASNVYYLYAARFLCGF-------TGGAGYL- 131

pombe   202 IWQPWLYPYF-----------------MCFWSLGAVGGPVLGPLLGAAMVVAKSWRWQFWLLMMI 249
                 :.|.|                 |....||.:.|.:|...|...:|.         .|.:|
  Fly   132 -----VVPIFISEVADSNIRGALTSMVMLSVDLGILAGYILSTYLAYHVVP---------FLAII 182

pombe   250 SALVLVIITFFMPETSEWHLLYKRAKRLRELTGNPNYKTEAEIASSQLSKGQFA----------- 303
            ..:...|....:|||:.:  |.|:::..........|:.:......|.||..|.           
  Fly   183 LPVAYFIANIMLPETAPY--LLKKSQLAAAENSFRYYRNQRSAICEQTSKVNFEELRTAVLSQQT 245

pombe   304 --------KQILVRPIILCVSEPIVLSLTIYIGLVYSILYLWFEAFPILFTTV-YHFTTIENGLV 359
                    |.:..:|.:...:..|||||......|:|.:....:.|....:.| .:..||..|||
  Fly   246 RNATPLSYKDLTTKPALKGFAASIVLSLGYQFSGVFSFINYMSDIFKASGSVVDVNTATIIIGLV 310

pombe   360 -YMGILVGSVLT--------------------VAF-YFIYLRKV--------------MIPKFVE 388
             .:|:...::|.                    :|| .|.||.|:              :|..:|.
  Fly   311 QIVGVYTSTILVDIVGRRVLMLISTMGVGIGCIAFGCFTYLAKIYDLSDFNWLPLVLMIIICYVA 375

pombe   389 NKG-----------KFPAE--------EILIIS---FPAAFFIPISLFWFGWTGRESVHWIVPIV 431
            |.|           .||.:        .::.:|   |......|:.|.::|            |.
  Fly   376 NIGLIGIFFLVLVELFPVKIRSLATSLSVIFLSLLVFGTLKLFPLMLHYWG------------IS 428

pombe   432 GTLFYASGSFLL 443
            .|:::::.|.||
  Fly   429 FTMWFSAASALL 440

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SPAC17C9.16cNP_001342868.1 MFS_1 89..478 CDD:311564 88/461 (19%)
2_A_01_02 126..264 CDD:273318 31/155 (20%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 89/464 (19%)
MFS_1 53..409 CDD:284993 73/387 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.