DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pcr1 and kay

Sequence 1:NP_594500.1 Gene:pcr1 PomBaseID:SPAC21E11.03c Length:171 Species:Schizosaccharomyces pombe
Sequence 2:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster

Alignment Length:192 Identity:39/193 (20%)
Similarity:72/193 (37%) Gaps:58/193 (30%)


pombe     9 DDEKRRRILERNRIAASKFRQKK----KEWIKELEQTANAAFEQSKRLQLLLSQLQQEAFRLKSQ 69
            :::||....|||:.||::.|:::    .|..:|:||.........|.:::|.:...|    |:..
  Fly   417 EEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQ----LEYL 477

pombe    70 LLAHQG-CQCSVKIRSVLTDFQTA------------------------HNA-------------- 95
            |..|:. ||   ||||.:....|.                        ||:              
  Fly   478 LATHRATCQ---KIRSDMLSVVTCNGLIAPAGLLSAGSSGSGASSHHNHNSNDSSNGTITGMDAT 539

pombe    96 LHSQHMAYRPVQPPPGDNMLESVVSVSPTQMHPSL--------QGLPPNQHPQMPPSSQQPN 149
            |:|...:..|:...|..|:...::.:....:..::        .|.||::...:||.|..|:
  Fly   540 LNSTGRSNSPLDLKPAANIDSLLMHIKDEPLDGAIDSGSSLDQDGPPPSKRITLPPMSTMPH 601

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pcr1NP_594500.1 bZIP_ATF2 12..72 CDD:269835 17/64 (27%)
coiled coil 12..72 CDD:269835 17/64 (27%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 17/65 (26%)
coiled coil 421..480 CDD:269869 16/63 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R103
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.