DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cnga2 and CG42260

Sequence 1:NP_037060.1 Gene:Cnga2 RGDID:2367 Length:664 Species:Rattus norvegicus
Sequence 2:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster

Alignment Length:483 Identity:229/484 (47%)
Similarity:312/484 (64%) Gaps:26/484 (5%)


  Rat   111 HQGDDKGGKDGEGK--------------------GTKKKFELFVLDPAGDWYYRWLFVIAMPVLY 155
            |.|...||..|.|.                    .|..:...||.||||...|.|..|::|..||
  Fly   529 HGGAGSGGGSGPGSHGGQPHHQKPRRTASQRIRAATAARKLHFVFDPAGRLCYYWSMVVSMAFLY 593

  Rat   156 NWCLLVARACFSDLQRNYFVVWLVLDYFSDTVYIADLIIRLRTGFLEQGLLVKDPKKLRDNYIHT 220
            |:.:::.|..|.::.|....:|..|||.||.:|:.|::...|||:||.|:|..|..|||.:|:::
  Fly   594 NFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFRTGYLEDGVLQTDALKLRTHYMNS 658

  Rat   221 LQFKLDVASIIPTDLIYFAVGIHSPEVRFNRLLHFARMFEFFDRTETRTSYPNIFRISNLVLYIL 285
            ..|.:|...::|.|.:|.::|.:| .:|..||:...|.:.|.||||..|:|||:||.:.|:.|:|
  Fly   659 TIFYIDCLCLLPLDFLYLSIGFNS-ILRSFRLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLL 722

  Rat   286 VIIHWNACIYYVISKSIGFGVDTWVYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDE 350
            ||.|||.|:|::|.|:.|||...|||   .|.|...:.::|:...||.||.|||||:.|.|....
  Fly   723 VIFHWNGCLYHIIHKNNGFGSRNWVY---HDSESADVVKQYLQSYYWCTLALTTIGDLPKPRSKG 784

  Rat   351 EYLFVIFDFLIGVLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKDMEAKVIKWF 415
            ||:|||...|.|:::|||::|:|.:::::::|.|.|||||:|.||.||:.|:|...::.||||||
  Fly   785 EYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWF 849

  Rat   416 DYLWTNKKTVDEREVLKNLPAKLRAEIAINVHLSTLKKVRIFQDCEAGLLVELVLKLRPQVFSPG 480
            ||||..:|..||...:..||.||:|||||||||.|||:|.|||:.|||.|.||||:|||.:||||
  Fly   850 DYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPG 914

  Rat   481 DYICRKGDIGKEMYIIKEGKLAVVADDGVTQYALLSAGSCFGEISILNIKGSKMGNRRTANIRSL 545
            |||||||::||||||:..|:|.||||:|.|..|.|.|||.||||||||:  ...||||||::||:
  Fly   915 DYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFGEISILNM--GTAGNRRTASVRSV 977

  Rat   546 GYSDLFCLSKDDLMEAVTEYPDAKKVLE 573
            ||||||.|||.|:.:.:.|||.|:..||
  Fly   978 GYSDLFVLSKKDMWDVLKEYPAARVRLE 1005

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cnga2NP_037060.1 Ion_trans 176..384 CDD:278921 87/208 (42%)
Radical_SAM 417..>470 CDD:302752 33/53 (62%)
Crp 450..626 CDD:223736 80/125 (64%)
CAP_ED 456..572 CDD:237999 74/116 (64%)
CLZ 572..641 CDD:293134 2/3 (67%)
CG42260NP_001356969.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45638
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.