DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: atf1 and kay

Sequence 1:NP_001342974.1 Gene:atf1 PomBaseID:SPBC29B5.01 Length:566 Species:Schizosaccharomyces pombe
Sequence 2:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster

Alignment Length:394 Identity:97/395 (25%)
Similarity:148/395 (37%) Gaps:80/395 (20%)


pombe   188 PSDASAAARFSSGTGFTPGVNEPFRSLLTPTGAGFPAPSPGTANLLGFHTFDSQFPDQYRFTPRD 252
            ||::.     ||.:|:.|  ..|.::.|..|.......:..|.|.....|..:.           
  Fly   153 PSESQ-----SSASGWNP--ETPGQAQLALTATTCNTTAAATCNTTAAATTSTT----------- 199

pombe   253 GKPPVVNGTNGDQSDYFGANAAVHGLCLLSQVPDQQQKLQQPISSENDQAASTTANNLLKQTQQQ 317
             ......|::.:.||.|..:|:.....|.:::     .|||..:.|..|:..|.....|..|..:
  Fly   200 -ATSAAAGSDNNHSDNFAMDASEIATFLANEL-----FLQQLGNFETGQSVLTLTTPTLTPTTTR 258

pombe   318 TFPDSIRP--SFTQNTNPQAVTGTMNPQASRTQQQPMYFMGSQQFNGMPS---VYGDTVNPADPS 377
            ...|::..  |.||........|...|:.                  :|:   |.|..:.....|
  Fly   259 NIEDTLGHLLSDTQTDRVAGCAGFAVPKV------------------LPNAIDVLGMGIPTGVSS 305

pombe   378 LTLRQTTDFS-GQNAE----NGSTNLPQKTSNSDMPTANSMPVKLENGTDYSTSQEPS------- 430
            |.|:||.|.| ||.:|    |.|.|..|.....|....:|.      .|| |||.:..       
  Fly   306 LPLQQTFDLSLGQGSESEDSNASYNDTQMNEEQDTTDTSSA------HTD-STSYQAGHIMAGSV 363

pombe   431 -----SNANNQSSPTSSINGKASSESAN----GTSYSKGSSRR--NSKNETDEEKRKSFL--ERN 482
                 :|.:|..:..||..|.||..|:|    .|...:|..||  .|.|.|.||::|..:  |||
  Fly   364 NGGGVNNFSNVLAAVSSSRGSASVGSSNANTSNTPARRGGGRRPNRSTNMTPEEEQKRAVRRERN 428

pombe   483 RQAALKCRQRKKQWLSNLQAKVEFYGNENEILSAQVSALREEIVSLKTLLIAHK-DCPVAKSNSA 546
            :|||.:||:|:....:.|..:||......|.:..::..|......|:.||..|: .|...:|:..
  Fly   429 KQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATHRATCQKIRSDML 493

pombe   547 AVAT 550
            :|.|
  Fly   494 SVVT 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
atf1NP_001342974.1 Aft1_HRA 152..234 CDD:314623 11/46 (24%)
Macoilin <280..>532 CDD:313022 74/282 (26%)
bZIP_ATF2 474..534 CDD:269835 18/62 (29%)
coiled coil 474..534 CDD:269835 18/62 (29%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 18/61 (30%)
coiled coil 421..480 CDD:269869 17/59 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R103
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.