DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SPCC569.05c and CG33282

Sequence 1:NP_588568.1 Gene:SPCC569.05c PomBaseID:SPCC569.05c Length:576 Species:Schizosaccharomyces pombe
Sequence 2:NP_001097067.1 Gene:CG33282 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster

Alignment Length:459 Identity:101/460 (22%)
Similarity:177/460 (38%) Gaps:98/460 (21%)


pombe   157 PAEAITTIFHISLTVSLLTMTVFLCGYIAGPIVWAPLSELSGRKLPLLIGMFGFGIFNISVAVAK 221
            |.:....:..||...|:|.:. .||    |.:..|.|.|.:|||..|.:....:....|.:..|.
  Fly    51 PLDFEVNLAQISWLGSMLGLD-SLC----GNLTIAMLIERAGRKFCLYLMAGPYACIWILIYCAS 110

pombe   222 DIQTIMMCRFFSGFFASAPLTVVAAAFADMYSNKHRGTAITIFAALVFDGPLVSPIIGGFLTKSY 286
            ::..:...||..||...|...||....:::..:..|| |:|....|..|    ..|:.|::..:|
  Fly   111 NVYYLYAARFLCGFTGGAGYLVVPIFISEVADSNIRG-ALTSMVMLSVD----LGILAGYILSTY 170

pombe   287 LGWRWTEYITSFMGFF---ALVIVYLFCDETYSKAIIRNKAKEYRAMSGNYFVHAKSE------- 341
            |.:    ::..|:...   |..|..:...||....:    .|...|.:.|.|.:.:::       
  Fly   171 LAY----HVVPFLAIILPVAYFIANIMLPETAPYLL----KKSQLAAAENSFRYYRNQRSAICEQ 227

pombe   342 ------EEVLT--VPDVAKNYLLVPMKLLFTEPIVFLITLYSSFVYAILYLLLEAYPIIFSEKRH 398
                  ||:.|  :....:|...:..|.|.|:|.:      ..|..:|:..|...:..:||...:
  Fly   228 TSKVNFEELRTAVLSQQTRNATPLSYKDLTTKPAL------KGFAASIVLSLGYQFSGVFSFINY 286

pombe   399 FS-----------MGVAELPYIGL--LVGVFIGSAINISFEPWYYRRCLALGGKPDPEARLPPMM 450
            .|           :..|.: .|||  :|||:. |.|.:..   ..||.|.|         :..|.
  Fly   287 MSDIFKASGSVVDVNTATI-IIGLVQIVGVYT-STILVDI---VGRRVLML---------ISTMG 337

pombe   451 I-------GCFMFPAGIFWLSWSGYYSYVHWIVPTLSGLATGCGILLIFLQCLNYLIDAYLFRA- 507
            :       |||.:.|.|:.||   .::::..::..:.......|::.||     :|:...||.. 
  Fly   338 VGIGCIAFGCFTYLAKIYDLS---DFNWLPLVLMIIICYVANIGLIGIF-----FLVLVELFPVK 394

pombe   508 --ASAVAANTIMRSAMAAG----FPLFAVQMFHNMGVGWAGSLLGFIAVALIPMPFAFFFFGRKI 566
              :.|.:.:.|..|.:..|    |||    |.|..|:.:.   :.|.|.:.:...|.|:.|.::.
  Fly   395 IRSLATSLSVIFLSLLVFGTLKLFPL----MLHYWGISFT---MWFSAASALLTFFYFWLFLQET 452

pombe   567 REKS 570
            :.||
  Fly   453 KGKS 456

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SPCC569.05cNP_588568.1 MFS 139..562 CDD:119392 98/450 (22%)
MFS_1 143..526 CDD:284993 89/414 (21%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 98/450 (22%)
MFS_1 53..409 CDD:284993 86/402 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.