DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atf3 and kay

Sequence 1:NP_037044.1 Gene:Atf3 RGDID:2165 Length:181 Species:Rattus norvegicus
Sequence 2:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster

Alignment Length:108 Identity:37/109 (34%)
Similarity:59/109 (54%) Gaps:12/109 (11%)


  Rat    58 MSSALESVTINNRPLEMSVT------------KSEVAPEEDERKRRRRERNKIAAAKCRNKKKEK 110
            :||:..|.::.:.....|.|            .:.:.|||::::..||||||.|||:||.::.::
  Fly   378 VSSSRGSASVGSSNANTSNTPARRGGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQ 442

  Rat   111 TECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTC 153
            |..|.:|.|:||.....::.:||.|.|.|..|.|:|..||.||
  Fly   443 TNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATHRATC 485

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atf3NP_037044.1 Basic motif. {ECO:0000255|PROSITE-ProRule:PRU00978} 88..110 11/22 (50%)
bZIP_ATF3 96..149 CDD:269870 21/53 (40%)
coiled coil 96..146 CDD:269870 20/50 (40%)
Leucine-zipper. {ECO:0000255|PROSITE-ProRule:PRU00978} 114..142 10/28 (36%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 25/61 (41%)
coiled coil 421..480 CDD:269869 25/59 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23351
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.