DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tshr and rk

Sequence 1:NP_037020.1 Gene:Tshr RGDID:3911 Length:764 Species:Rattus norvegicus
Sequence 2:NP_476702.1 Gene:rk FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster

Alignment Length:780 Identity:248/781 (32%)
Similarity:368/781 (47%) Gaps:138/781 (18%)


  Rat     4 GSLLQLT----------LLLALPRSLWGRGCTSPPCECHQEDDFRVTCKELHQI--PSLPPSTQT 56
            |:|..||          |:.:||..|         .:..|..:..:|...|..|  ..||.|.|.
  Fly   341 GALKNLTALKVLELDDNLISSLPEGL---------SKLSQLQELSITSNRLRWINDTELPRSMQM 396

  Rat    57 LKLIETHLKTIPSLAFSSLPNISRIYLSIDATLQRLEPHSFYNLSKMTHIEI--RNTRSLTYIDP 119
            |.:....|.||...||..:..:.::.||...||:     ||..|.....:||  .:...:..:..
  Fly   397 LDMRANPLSTISPGAFRGMSKLRKLILSDVRTLR-----SFPELEACHALEILKLDRAGIQEVPA 456

  Rat   120 DALTELPLLKFLGIFNTGLRIFPDLTKIYSTDVFFILEITDNPYMTSVPENAFQGLCNETLTLKL 184
            :...:.|.||.|.:....|:..|:|:.                             |.:...|.|
  Fly   457 NLCRQTPRLKSLELKTNSLKRIPNLSS-----------------------------CRDLRLLDL 492

  Rat   185 YNNGFTSIQGHAFNGTK-LDAVYLNKNKYLTAIDKDAFGGV--------------------YSGP 228
            .:|....|||..|||.| |:.:.|:.|: :.|:.:|||.|:                    :||.
  Fly   493 SSNQIEKIQGKPFNGLKQLNDLLLSYNR-IKALPQDAFQGIPKLQLLDLEGNEISYIHKEAFSGF 556

  Rat   229 TLLD---VSSTSVTALPSKGLEHLKELIAKNTWTLKKLPLSLSFLHLTRADLSYPSHCCAF---- 286
            |.|:   :.:.....||..||..|..|...|...|::.|...:|..:....|||..|||||    
  Fly   557 TALEDLNLGNNIFPELPESGLRALLHLKTFNNPKLREFPPPDTFPRIQTLILSYAYHCCAFLPLV 621

  Rat   287 --KNQKKIRGILESL-----------MCNESSIRNLRQRKSVNVMRG-PVYQEYEEGLGDNHVGY 337
              .:|||...:.|::           :.|.|.:....|..:::...| .::..:|..:..|    
  Fly   622 AMSSQKKTSQVQEAVLFPSDAEFDMTLWNNSMMNIWPQMHNLSKQLGASMHDPWETAINFN---- 682

  Rat   338 KQNSKFQEGP--SNSHYYVFFEEQE----DEIIGFGQEL-KNPQEETLQAFDSHYDYTVCGDNED 395
            ::..:.|.|.  :.|:...:|||.:    ....|||..| .....|..|.             ..
  Fly   683 EEQLQTQTGGQIATSYMEEYFEEHDVSGPATGYGFGTGLFSGMSTEDFQP-------------GS 734

  Rat   396 MVCTPKSDEFNPCEDIMGYKFLRIVVWFVSPMALLGNVFVLFVLLTSHYKLTVPRFLMCNLAFAD 460
            :.|.|....|.||.|:..:..||..||.|..::||||..|:||||.|..|:.|||||:||||.||
  Fly   735 VQCLPMPGPFLPCADLFDWWTLRCGVWVVFLLSLLGNGTVVFVLLCSRSKMDVPRFLVCNLAAAD 799

  Rat   461 FCMGVYLLLIASVDLYTHTEYYNHAIDWQTGPGCNTAGFFTVFASELSVYTLTVITLERWYAITF 525
            |.||:||.::|.||..|..|:...||.||....|..:||..|.:||||||||.||||||.||||.
  Fly   800 FFMGIYLGILAIVDAATLGEFRMFAIPWQMSVLCQLSGFLAVLSSELSVYTLAVITLERNYAITH 864

  Rat   526 AMRLDRKIRLRHAYTIMAGGWVSCFLLALLPMVGISSYAKVSICLPMDTDT-PLALAYIALVLLL 589
            |:.|::::.|:.|..||:.|||...::||:|:||:|.|.|.::|||.:|.| |.:|.|:..::.:
  Fly   865 AIHLNKRLSLKQAGYIMSVGWVFALIMALMPLVGVSDYRKFAVCLPFETTTGPASLTYVISLMFI 929

  Rat   590 NVVAFVIVCSCYVKIYITVRNPQ-YNPRDKDTKIAKRMAVLIFTDFMCMAPISFYALSALMNKPL 653
            |..||:.:..||:|:|..:|..| :|  ..|::||||||:|:||||:|.:||:|::::|:....|
  Fly   930 NGCAFLTLMGCYLKMYWAIRGSQAWN--TNDSRIAKRMALLVFTDFLCWSPIAFFSITAIFGLQL 992

  Rat   654 ITVTNSGVLLVLFYPLNSCANPFLYAIFTKAFQRDVFILLSKFGLCKHQAQAYQAQRVCPNNNTG 718
            |::..:.:..|...|||||.|||||||.||.|::|...      ||||    ::..||......|
  Fly   993 ISLEQAKIFTVFVLPLNSCCNPFLYAIMTKQFKKDCVT------LCKH----FEESRVVGGGGPG 1047

  Rat   719  718
              Fly  1048  1047

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TshrNP_037020.1 leucine-rich repeat 54..77 CDD:275380 7/23 (30%)
LRR_5 65..221 CDD:290045 37/159 (23%)
leucine-rich repeat 78..102 CDD:275380 7/24 (29%)
LRR 1 100..124 3/26 (12%)
leucine-rich repeat 103..127 CDD:275380 3/26 (12%)
LRR 2 125..150 7/25 (28%)
leucine-rich repeat 128..177 CDD:275380 7/49 (14%)
LRR 3 151..174 0/23 (0%)
LRR 4 176..199 9/23 (39%)
leucine-rich repeat 180..201 CDD:275380 9/21 (43%)
LRR 5 201..223 8/23 (35%)
leucine-rich repeat 202..229 CDD:275380 10/47 (21%)
LRR 6 225..248 8/26 (31%)
leucine-rich repeat 230..251 CDD:275380 6/24 (25%)
LRR 7 264..288 10/30 (33%)
7tm_4 417..609 CDD:304433 95/193 (49%)
7tm_1 431..678 CDD:278431 120/249 (48%)
PDZ-binding 762..764
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380
LRR_RI 180..>383 CDD:238064 11/51 (22%)
leucine-rich repeat 183..204 CDD:275380
LRR_8 203..263 CDD:290566
leucine-rich repeat 205..228 CDD:275380
leucine-rich repeat 229..252 CDD:275380
LRR_8 252..311 CDD:290566
leucine-rich repeat 253..276 CDD:275380
leucine-rich repeat 277..300 CDD:275380
LRR_8 299..359 CDD:290566 5/18 (28%)
leucine-rich repeat 301..324 CDD:275380
leucine-rich repeat 325..348 CDD:275380 4/7 (57%)
LRR_RI 327..567 CDD:238064 61/270 (23%)
leucine-rich repeat 349..371 CDD:275380 4/31 (13%)
LRR_8 370..425 CDD:290566 16/55 (29%)
leucine-rich repeat 372..393 CDD:275380 5/21 (24%)
leucine-rich repeat 394..415 CDD:275380 7/21 (33%)
leucine-rich repeat 418..486 CDD:275380 17/102 (17%)
leucine-rich repeat 441..464 CDD:275378 3/23 (13%)
LRR_8 487..545 CDD:290566 18/59 (31%)
leucine-rich repeat 487..510 CDD:275380 10/23 (43%)
leucine-rich repeat 511..534 CDD:275380 8/24 (33%)
LRR_8 533..589 CDD:290566 11/56 (20%)
leucine-rich repeat 535..558 CDD:275380 3/23 (13%)
leucine-rich repeat 559..580 CDD:275380 5/21 (24%)
7tm_4 764..>892 CDD:304433 67/128 (52%)
7tm_1 770..1017 CDD:278431 120/249 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001020
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.