DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sstr5 and AstC-R1

Sequence 1:NP_037014.2 Gene:Sstr5 RGDID:3765 Length:362 Species:Rattus norvegicus
Sequence 2:NP_649040.2 Gene:AstC-R1 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster

Alignment Length:369 Identity:145/370 (39%)
Similarity:208/370 (56%) Gaps:44/370 (12%)


  Rat     5 SLASTPSW---NASAASSG-NHNW-----------SLVGSASPMGARAV---------LVPVLYL 45
            |.|:..:|   |.|..::. ||.|           ||.|:..|.....:         ...|||.
  Fly    21 SEANATNWYNTNESLYTTELNHRWISGSSTIQPEESLYGTDLPTYQHCIATRNSFADLFTVVLYG 85

  Rat    46 LVCTVGLSGNTLVIYVVLRHAKMKTVTNVYILNLAVADVLFMLGLPFLATQNAVSYWPFGSFLCR 110
            .||.:||.|||||||||||.:||:||||:|||||||||..|::|:|||.....:..|.||.|:|:
  Fly    86 FVCIIGLFGNTLVIYVVLRFSKMQTVTNIYILNLAVADECFLIGIPFLLYTMRICSWRFGEFMCK 150

  Rat   111 LVMTLDGINQFTSIFCLMVMSVDRYLAVVHPLRSARWRRPRVAKMASAAVWVFSLLMSLPLLVFA 175
            ..|....|..|||...|::||.|||:||.||:.|.|:|...:||:.||..|..|.::.||::::|
  Fly   151 AYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTLHIAKVVSAIAWSTSAVLMLPVILYA 215

  Rat   176 D-VQEGWG---TCNLSWPEPVGLW-GAAFITYTSVLGFFGPLLVICLCYLLIVVKVKAAGMRVG- 234
            . |::..|   :||:.||:..... |..||.||..|||..||..|...|.|::.|:::.|.:.| 
  Fly   216 STVEQEDGINYSCNIMWPDAYKKHSGTTFILYTFFLGFATPLCFILSFYYLVIRKLRSVGPKPGT 280

  Rat   235 -SSRRRRSERKVTRMVVVVVLVFVGCWLPFFIVNIVNLAFTLPEEPTSAGL----YFFVVVLSYA 294
             |..:||:.|||||:|:.|:.|::.||||.:|..:. |..:.|.:...:.|    :..:..|.|:
  Fly   281 KSKEKRRAHRKVTRLVLTVISVYILCWLPHWISQVA-LIHSNPAQRDLSRLEILIFLLLGALVYS 344

  Rat   295 NSCANPLLYGFLSDNFRQSFRKVL-CLRRGYGMEDADA---IEP 334
            ||..||:||.|||:|||:||.|.. |:.:    :|.:|   :||
  Fly   345 NSAVNPILYAFLSENFRKSFFKAFTCMNK----QDINAQLQLEP 384

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sstr5NP_037014.2 7tm_4 48..>227 CDD:304433 86/184 (47%)
7tm_1 54..303 CDD:278431 111/260 (43%)
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 124/281 (44%)
7tm_1 94..353 CDD:278431 111/260 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BCR0
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 260 1.000 Inparanoid score I2975
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000204
OrthoInspector 1 1.000 T131075
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24229
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.