DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsd17b1 and CG31937

Sequence 1:NP_036983.1 Gene:Hsd17b1 RGDID:2836 Length:344 Species:Rattus norvegicus
Sequence 2:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster

Alignment Length:289 Identity:77/290 (27%)
Similarity:118/290 (41%) Gaps:43/290 (15%)


  Rat     1 MDSTVVLITGCSSGIGLHLAVRLASDRSQSFKVYATLRDLKS----QGPLLEAARAQGCPPGSLE 61
            |...||.|||.|||||..||:.||   ....|:..:.|.|:.    |...|.|||........| 
  Fly    44 MRGQVVWITGASSGIGRALALSLA---RHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVL- 104

  Rat    62 ILELDVRDSESVAAARACVTE--GRVDVLVCNAGRGLFGPLEAHELNAVGAVLDVNVLGTIRMLQ 124
            ::::|:.|.:........|..  .|:||||.||||.........|:.....:.:::|...:.:.:
  Fly   105 VIQMDMLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSR 169

  Rat   125 AFLPDMKRRHSGR--VLVTASVGGLMGLPFHEVYCASKFALEGLCESLAILLPLFGVHVSLIECG 187
            ..:.....::.||  :..|:|:.|...:||...|||:|.||.....||.:  .:..:.|||...|
  Fly   170 LVVRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKV--EMRKLDVSLFAPG 232

  Rat   188 AVHTAF-HEKLEGGPGGALERADAQTRHLFAHYQRGYEQALSEAQDPEEVTELFLTAMR------ 245
            .:.|.| .|...|..||.:..:.|..:.:.|                :...:||..|:.      
  Fly   233 PIATDFLQEAFTGSQGGKVGLSTANQKRMTA----------------QRCGDLFAVALANKMDLT 281

  Rat   246 ----APQPALRYFSTNRFLP--LARMRTE 268
                .|...|.|.:.|..|.  ||::.||
  Fly   282 WCGLFPVNLLAYCARNPTLSKILAQLMTE 310

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsd17b1NP_036983.1 NADB_Rossmann 4..260 CDD:304358 71/275 (26%)
adh_short 5..192 CDD:278532 57/195 (29%)
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 70/271 (26%)
adh_short 47..245 CDD:278532 59/204 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.