DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Egf and arr

Sequence 1:NP_036974.1 Gene:Egf RGDID:2542 Length:1133 Species:Rattus norvegicus
Sequence 2:NP_524737.2 Gene:arr FlyBaseID:FBgn0000119 Length:1678 Species:Drosophila melanogaster

Alignment Length:1311 Identity:288/1312 (22%)
Similarity:451/1312 (34%) Gaps:458/1312 (35%)


  Rat    41 AAAGPPRFLIFLQGNSIFRIN----TDGTNHQQLVVDAGVSVVMDFHYKEERLYWVDLERQLLQR 101
            |....|..|:|...:.|...|    |.|.....:|.|...::.:||:|.:..:.|.|..|::::.
  Fly    81 AFVNTPATLLFTTRHDIQVANITRPTGGPQIDVIVRDLAEAMAIDFYYAKNLVCWTDSGREIIEC 145

  Rat   102 VFFNGSGQETVCKVDKNV---------SGLAINWIDGEILRTDRWKGVITVTDMNGNNSRVLL-S 156
            ...|.|..:.:.:..|..         .|||::|...:|..||..|..|.|..::|...:||. :
  Fly   146 AQTNSSALQPLLRAPKQTVISTGLDKPEGLAMDWYTDKIYWTDGEKNRIEVATLDGRYQKVLFWT 210

  Rat   157 SLKRPANILVDPTERLIFWSSVVTG---NLHRADLGGMDVKTLLEAPERI---SVLILDILDKRL 215
            .|.:|..:.|.|..:|:.|:.  .|   .:.||.:.|..:..:....|.:   :.|.:|:.::.:
  Fly   211 DLDQPRAVAVVPARKLLIWTD--WGEYPKIERASMDGDPLSRMTLVKEHVFWPNGLAVDLKNELI 273

  Rat   216 FWAQDGREGSHGYIHSCDYNGGSIHHIRHQARHDLLTMAIFGDKILYSALKEKAIWIADKHTGKN 280
            :|.    :|.|.:|.....:|.|...|.:..::. .::..:.|::.::.      |         
  Fly   274 YWT----DGKHHFIDVMRLDGSSRRTIVNNLKYP-FSLTFYDDRLYWTD------W--------- 318

  Rat   281 VVRVNLDPASVPPRELRVVHLHAQPGTENRAQASDSERCKQRRGQCLYSLSERDPNSDSSACAEG 345
             .|.:|:...:..|||:  .|...|...|..:|.|.            ||   .|..|       
  Fly   319 -QRGSLNALDLQTRELK--ELIDTPKAPNSVRAWDP------------SL---QPYED------- 358

  Rat   346 YTLSRDRKYCEDVNECALQNHGCTLGCENIPGSYYCTCPTGFVLLPDGKRCHELVACPGNRSECS 410
                         |.||..|                                      ||   ||
  Fly   359 -------------NPCAHNN--------------------------------------GN---CS 369

  Rat   411 HDCIL--TSDGPLCICPAGSVLGKDGKTCTGCSFSDNGGCSQICLPLSLASWECDCFPGYDLQLD 473
            |.|:|  .|.|..|.||.|..|                                         :.
  Fly   370 HLCLLATNSQGFSCACPTGVKL-----------------------------------------IS 393

  Rat   474 RKSCAASMGPQPFLLFANSQDIRHMHFDGTDYKTLLSRQMGMV---FALDYDPVESKIYFAQTAL 535
            ..:||  .|.|..:.......|..:..|..|| |:....:|.|   .|:||||||..||::....
  Fly   394 ANTCA--NGSQEMMFIVQRTQISKISLDSPDY-TIFPLPLGKVKYAIAIDYDPVEEHIYWSDVET 455

  Rat   536 KWIERANLDGSQRERRITEGVDTPEGLAVDWIGRRIYWTDSGKSVIEGSDLSGKHHQIIIKESIS 600
            ..|:||:.||:.....:|..|..|:|||:||:.|.:||||:....||...|.|...:::|.|.:.
  Fly   456 YTIKRAHADGTGVTDFVTSEVRHPDGLALDWLARNLYWTDTVTDRIEVCRLDGTARKVLIYEHLE 520

  Rat   601 RPRGIAVHPKARRLFWTD-TGMSPRIESSSLQGSDRTLIASSNLLEPSGIAIDYLTDTLYWCDTK 664
            .||.|||.|....:||:| ....|::|.:||.||:|.::.|.||..|:|||:|.....:||||.|
  Fly   521 EPRAIAVAPSLGWMFWSDWNERKPKVERASLDGSERVVLVSENLGWPNGIALDIEAKAIYWCDGK 585

  Rat   665 LSVIEMADLDGSKRRRLTQNDVGHPFSLAVFEDHVWFSDWAIPSVIRVNKRTGQNRV-------R 722
            ...||:|::|||.||.:..:::.|.|.|::.:|:::::||...|:.|.:|.||.||:       .
  Fly   586 TDKIEVANMDGSGRRVVISDNLKHLFGLSILDDYLYWTDWQRRSIDRAHKITGNNRIVVVDQYPD 650

  Rat   723 LRGSMLKPSSLVVVHPLAKPGADPCLHRNGGCEHICQESLGTAQCLCREGFVKAPDGKMCL---- 783
            |.|  ||.:.|..|.     |.:.|..|||||.|:|........|.|...:..|.|.:.|:    
  Fly   651 LMG--LKVTRLREVR-----GQNACAVRNGGCSHLCLNRPRDYVCRCAIDYELANDKRTCVVPAA 708

  Rat   784 --------------------TRKDDQILAGDNAD---LSKEVAS-----LDNSPK----AYVPDD 816
                                ...|::|...|..|   |...||.     .|...|    |::   
  Fly   709 FLLFSRQEHIGRISIEYNEGNHNDERIPFKDVRDAHALDVSVAERRIYWTDQKSKCIFRAFL--- 770

  Rat   817 DRTESSTLVAEIMVSGLNYEDDCGPGGC-------------------------GSHAHC-----I 851
                :.:.|..|:.|||     .||.|.                         ||....     :
  Fly   771 ----NGSYVQRIVDSGL-----IGPDGIAVDWLANNIYWSDAEARRIEVARLDGSSRRVLLWKGV 826

  Rat   852 SEGEAAVCQCLKGF--------------AGDGNLCSDIDECELGSSDCP-------------PTS 889
            .|..:.|.:..:|:              |.||   ||:.....|::...             .|.
  Fly   827 EEPRSLVLEPRRGYMYWTESPTDSIRRAAMDG---SDLQTIVAGANHAAGLTFDQETRRLYWATQ 888

  Rat   890 SRCINTEG----GYVCQCSEGYEGDGIYCLDV--------------------------------- 917
            ||....|.    |...|...|.:.|..|.:.:                                 
  Fly   889 SRPAKIESADWDGKKRQILVGSDMDEPYAVSLYQDYVYWSDWNTGDIERVHKTTGQNRSLVHSGM 953

  Rat   918 ----------DECQQGSHGCSENATCTNTEGGYNCTCAGCPSAPGLPCPDSTSPSLLGKDG--CH 970
                      |:.|.|.:.|..|      .||.:..|...|...|:.|...|... |.|||  |.
  Fly   954 TYITSLLVFNDKRQTGVNPCKVN------NGGCSHLCLAQPGRRGMTCACPTHYQ-LAKDGVSCI 1011

  Rat   971 WVRN---------------SNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDL 1020
            ..||               :.|.||                        |..:...|:       
  Fly  1012 PPRNYIIFSQRNCFGRLLPNTTDCP------------------------NIPLPVSGK------- 1045

  Rat  1021 RWWKLRHADY-----------GQRHDI-------TVVSVCV-------VALALLLLLGMWGTYYY 1060
               .:|..||           |:.|.|       |.||:..       :|:.::..|..|..   
  Fly  1046 ---NIRAVDYDPITHHIYWIEGRSHSIKRSLANGTKVSLLANSGQPFDLAIDIIGRLLFWTC--- 1104

  Rat  1061 RTRKQLSESSKKPSEESSSNVSSNGPDSSGAGVSSGPQPWFVVLEEHQQPKNGRLPA-------- 1117
                         |:.:|.||:|...:|.|. :.:|         :.::|:|..:.|        
  Fly  1105 -------------SQSNSINVTSFLGESVGV-IDTG---------DSEKPRNIAVHAMKRLLFWT 1146

  Rat  1118 -AGTNGAVVEA 1127
             .|::.|::.|
  Fly  1147 DVGSHQAIIRA 1157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
EgfNP_036974.1 LDL-receptor class B 1 87..128 10/50 (20%)
LDL-receptor class B 2 129..170 13/42 (31%)
LY 152..193 CDD:214531 12/45 (27%)
LDL-receptor class B 3 171..212 9/47 (19%)
LDL-receptor class B 4 213..259 8/46 (17%)
vWFA <353..394 CDD:294047 4/41 (10%)
FXa_inhibition 409..437 CDD:291342 12/30 (40%)
FXa_inhibition 444..477 CDD:291342 0/33 (0%)
LDL-receptor class B 5 485..525 13/43 (30%)
LY 506..548 CDD:214531 17/45 (38%)
LDL-receptor class B 6 526..568 15/42 (36%)
LY 552..591 CDD:214531 17/39 (44%)
LDL-receptor class B 7 569..611 17/42 (40%)
LY 592..635 CDD:214531 17/44 (39%)
LDL-receptor class B 8 612..655 18/44 (41%)
LY 635..678 CDD:214531 20/43 (47%)
LDL-receptor class B 9 656..698 17/42 (40%)
LY 679..720 CDD:214531 13/41 (32%)
FXa_inhibition 747..782 CDD:291342 12/35 (34%)
EGF_3 840..872 CDD:289699 11/76 (14%)
EGF_CA 874..914 CDD:214542 11/57 (19%)
EGF_3 920..>944 CDD:289699 6/24 (25%)
PHA03099 <979..>1017 CDD:165381 4/38 (11%)
arrNP_524737.2 LY 162..201 CDD:214531 10/39 (26%)
NHL 168..503 CDD:302697 107/480 (22%)
NHL repeat 172..237 CDD:271320 20/67 (30%)
LY 252..293 CDD:214531 9/45 (20%)
NHL repeat 261..298 CDD:271320 9/41 (22%)
NHL repeat 303..339 CDD:271320 8/55 (15%)
NHL repeat 341..419 CDD:271320 30/197 (15%)
NHL repeat 428..476 CDD:271320 17/48 (35%)
LY 472..511 CDD:214531 17/39 (44%)
NHL repeat 477..503 CDD:271320 13/26 (50%)
Ldl_recept_b 534..573 CDD:278487 17/39 (44%)
LY 558..599 CDD:214531 19/41 (46%)
LY 600..641 CDD:214531 13/41 (32%)
FXa_inhibition 668..703 CDD:291342 12/35 (34%)
LY 739..773 CDD:214531 8/41 (20%)
LY 776..818 CDD:214531 9/47 (19%)
LY 819..860 CDD:214531 7/44 (16%)
FXa_inhibition 973..1010 CDD:291342 13/44 (30%)
LY 1122..1164 CDD:214531 7/47 (15%)
FXa_inhibition 1273..1313 CDD:291342
LDLa 1319..1362 CDD:238060
LDLa 1365..1399 CDD:238060
LDLa 1399..1433 CDD:197566
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46513
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.