DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp24a1 and Cyp12b2

Sequence 1:NP_963966.1 Gene:Cyp24a1 RGDID:2462 Length:514 Species:Rattus norvegicus
Sequence 2:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster

Alignment Length:502 Identity:134/503 (27%)
Similarity:233/503 (46%) Gaps:59/503 (12%)


  Rat    51 ETRNVTSLPGPTNWPLLGSLLEIFWKGGLKKQHDTLAE---YHKKYGQIFRM--KLGSFDSVHLG 110
            :.|:...:|||:    |..:|..|..||..:..:.:..   ..:.||.|:.:  .:|..::|...
  Fly    49 QARSFGEIPGPS----LLRMLSFFMPGGALRNTNLIQMNRLMREMYGDIYCIPGMMGKPNAVFTY 109

  Rat   111 SPSLLEALYRTESAHPQRLEIKPWKAYRD-HRNEAY----GLMILEGQEWQRVRSAFQKKLMKPV 170
            :|...|..||.|...|.|:.::....||. ||.:.:    ||...:||||..:|:.....|||..
  Fly   110 NPDDFEMTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVGGLASDQGQEWADIRNKVNPVLMKVQ 174

  Rat   171 EIMKLDKKINEVLADFLERMDELCDERGRIP-------DLYSELNKWSFESICLVLYEKRFGLLQ 228
            .:.:...:::::..:|::::     |..|.|       |.:::|..|:||||..|....|.|||.
  Fly   175 NVRQNLPQLDQISKEFIDKL-----ETQRNPETHTLTTDFHNQLKMWAFESISFVALNTRMGLLS 234

  Rat   229 KETEEEALTFITAIKTMMSTFGKMMVTPVELHKRLNTKVWQAHTLA--------WDTIFKSVKPC 285
            ...:..|......::...:...:..|.|         .:|..:..|        :|.|.......
  Fly   235 DNPDPNADRLAKHMRDFFNYSFQFDVQP---------SIWTFYKTAGFKKFLKTYDNITDITSNY 290

  Rat   286 IDNRLQRYSQQPGADFLCDIYQQDHLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQAQR 350
            |:..::.:.:.......|.:.|....:||.....|.::.:|.::||:::.:.|||:|:|||..|.
  Fly   291 IETAMRGFGKNDDGKTKCVLEQLLEHNKKVAVTMVMDMLMAGIDTTSSACLTILYHLARNPSKQE 355

  Rat   351 RLLQEVQSVLP---DNQTPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKPTVLGEYALPKG 412
            :|.:|:..:||   |:.|.  ::.:|||||:||:||.:|:|...|...|...|..||..|.:|:|
  Fly   356 KLRRELLRILPTTKDSLTD--QNTKNMPYLRACIKEGLRITSITPGNFRITPKDLVLSGYQVPRG 418

  Rat   413 TVLTLNTQVLGSSEDNFEDSHKFRPERWLQKE-----------KKINPFAHLPFGIGKRMCIGRR 466
            |.:.:....|.:.:..|..|.:|.|||||:.:           :..|||.:||||.|.|.|||:|
  Fly   419 TGVLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPAARTRNPFVYLPFGFGPRTCIGKR 483

  Rat   467 LAELQLHLALCWIIQKYDIVATDNEPVEMLHLGILVPSRELPIAFRP 513
            :|||::...|..:::.|.:......|:|.....||.|..::.....|
  Fly   484 IAELEIETLLVRLLRSYKVSWLPETPIEYESTIILSPCGDIRFKLEP 530

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp24a1NP_963966.1 p450 59..509 CDD:278495 132/489 (27%)
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 126/472 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H68094
Inparanoid 1 1.050 200 1.000 Inparanoid score I3652
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 1 1.000 FOG0001319
OrthoInspector 1 1.000 T131183
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.