DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: X11L and CG15803

Sequence 1:NP_001285376.1 Gene:X11L FlyBaseID:FBgn0026313 Length:1170 Species:Drosophila melanogaster
Sequence 2:NP_001287388.1 Gene:CG15803 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster

Alignment Length:806 Identity:156/807 (19%)
Similarity:259/807 (32%) Gaps:291/807 (36%)


  Fly   498 SALISDFASLPMPP---------------------------------APPPSSPPQIEIADASES 529
            |.|..|.|..|:||                                 :|||.  |.:::......
  Fly   196 SELAGDLADFPLPPIPGGGGHSMVTDSNAGQRPCPRLDLDIVPFSILSPPPR--PALQMLPLETQ 258

  Fly   530 MTMVPDADNPLDSHYGAVYAAAL--------GGTHTEKSAGS----------------------G 564
            ...|.|.:.    |...|.|.:.        ||:.:...:||                      |
  Fly   259 WRCVQDQNR----HIETVIADSKRKLLANEDGGSASASGSGSPDSYMDSPETETYVVELHKNVYG 319

  Fly   565 LGVTPVTAGGSLPSQAASEIQEAMKEIRSALQRAKTQPE-KLKFCDEVLPTDPDSPVWVPRKGTT 628
            ||:|  .||.....:..|.|     .::|.::.:..:.. :::..|.::..|..|     ..|.|
  Fly   320 LGIT--VAGYVCEEEDLSGI-----FVKSIIEGSAAETSGQIQINDRIVAVDGRS-----LSGVT 372

  Fly   629 ISTAQGAAADEEPDTDLETDRLLGQQRHDEQDFFADQSLADNNANEGTDIASNGHLNGTSDNNNP 693
            ...|.....:.:....|..:|.|..::::.......:.       :||...|.  |:.:.|.:..
  Fly   373 NHQAVELLRNTDIVVHLTLERFLRGRKYEHLQVALTEI-------KGTSAPSG--LDRSQDKDQD 428

  Fly   694 NPMNNSKPQTYSTATIRQGIGTSLTPNSPDICQIVGTTD-------ISISSPEKLQFTKSPTGSI 751
            .....|.|.:.|.||:     :.|.|.|.|...|....|       :.||..|. :|.:.|:   
  Fly   429 QESQLSMPGSPSIATL-----SWLPPKSLDADSIATEGDEAVDAEYVGISGAED-EFIELPS--- 484

  Fly   752 KSLKDSANSDKK---AKSRNKEGLLE---PKVLIEGVLFRARYL-------GSTQLVCEGQPTKS 803
               :|:..|:..   .:|.:..||.:   |::.....|...|.|       ..|...| .:|...
  Fly   485 ---RDTVESNMSHVLDRSDHSGGLTKDQVPRISPIVPLTNGRSLILADDSGNDTDEQC-AEPETE 545

  Fly   804 TRMMQAEEAVSRIKALAPEGESQPSTEVDLFISTEKIMVLNTDLKEIMMDHALRTISYIADIGDL 868
            |             |.|.:| |:|.||                              .:.|:|| 
  Fly   546 T-------------AQARKG-SKPETE------------------------------RVKDLGD- 565

  Fly   869 VVLMARRRFVPNSVVDPSITSPLGDVPTPGIGEEESPPK--EPLSKHNRTPKMICHVFESDEAQF 931
                .:....|:..:||      |.:|||   ..|:|.|  .|.:...|                
  Fly   566 ----TKTDTDPDPDLDP------GQMPTP---TNEAPVKAASPTAASLR---------------- 601

  Fly   932 IA-QSIGQAFQVA-------------YMEFLKANG-IENESLAKEMDYQEVLNSQEIFG-DELEI 980
            :| :|:|.:.:..             |:..:.|:| :..:.:.:..|....:|..::.| ..:|:
  Fly   602 VAWKSLGISLEGTVDVECGIEKRPHHYIRSILADGPVGRQGILRPGDELLQVNEHKLQGLRHIEV 666

  Fly   981 F-AKKELQKEVVVPKAKGEILGVVIVES------GWGSMLP--------------------TVVI 1018
            . ..|||...|.:..|:|..:..||..|      ...|:||                    |...
  Fly   667 VKILKELPARVKLVCARGTHVPSVINTSQNPEAFETRSLLPGGHQSLQNLLSKAQSESSLYTSST 731

  Fly  1019 ANLMSSGAAA--RCGQLNIGDQLIAINGMSLVGLPLSTCQSYIRNAKNQTAVKFTVVPCPPVVEV 1081
            |.|..:||||  ..|....|.:..::..:|  ||.|.:|:                     |..|
  Fly   732 ATLTDAGAAAGGSGGTAGGGARSKSLENVS--GLALWSCE---------------------VTAV 773

  Fly  1082 KILRPKALFQLGFSV--------QNG---VICSLLRGGIAE-RGGVRVGHRIIEINNQSVVAVPH 1134
            .|.:.:..|  |||:        ..|   ||..|:|||.|| ...:..|.|::.:.::.:..:..
  Fly   774 DIEKTEQGF--GFSILDYQDPLDSEGSVIVIRGLIRGGAAEATNEIYPGDRLMSVGDRLLQGLEL 836

  Fly  1135 DTIVKLLSSSVGEILMKTMPTSMFRL 1160
            |..|.:|         |.||..:.||
  Fly   837 DEAVSIL---------KAMPPGLTRL 853

Known Domains:


GeneSequenceDomainRegion External IDIdentity
X11LNP_001285376.1 PTB_X11 775..954 CDD:269919 36/203 (18%)
PDZ_signaling 988..1065 CDD:238492 23/105 (22%)
PDZ_signaling 1092..1151 CDD:238492 17/71 (24%)
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492
PDZ 307..393 CDD:214570 16/98 (16%)
PDZ_signaling 605..680 CDD:238492 13/75 (17%)
PDZ 773..858 CDD:214570 25/93 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.