DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gstt1 and GstE12

Sequence 1:NP_445745.1 Gene:Gstt1 RGDID:2765 Length:240 Species:Rattus norvegicus
Sequence 2:NP_001246500.1 Gene:GstE12 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster

Alignment Length:204 Identity:61/205 (30%)
Similarity:100/205 (49%) Gaps:27/205 (13%)


  Rat     5 LYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFAQVNPMKKVPAMKDGGFTLCESVA 69
            ||...||.|.||:.:.||...:..::..:.|.|||||:..|.::||...:|.:.||..|:.:|.|
  Fly     6 LYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATIIDSHA 70

  Rat    70 ILLYLAHKY-KVPDHWYPQDLQARARVDE--YLAWQHTTLRRSCLRTLWHKVMFPVFLGEQIRPE 131
            |..||..|| :.....||::|..||.||.  :|...|...|   ||.|:..:::           
  Fly    71 ICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFAR---LRFLYEPILY----------- 121

  Rat   132 MLAATLADLDVNV------QVLEDQFLQDKDFLVGPHISLADVVAITELMHPVGGGCPVFEGR-P 189
             ..:|...:|...      ::||. ||:|:.:|.|..:::||..|:..:. .|....|:.|.: |
  Fly   122 -YGSTDCSIDKIAYIQKCWEILEG-FLKDQPYLCGSDLTIADFCAVATVT-SVNDTAPIDEFKFP 183

  Rat   190 RLAAWYRRV 198
            ::.||.:|:
  Fly   184 KMHAWLKRL 192

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gstt1NP_445745.1 GST_C_Theta 91..217 CDD:198292 29/118 (25%)
GstA 3..201 CDD:223698 61/205 (30%)
GST_N_Theta 3..78 CDD:239348 28/73 (38%)
Glutathione binding. {ECO:0000250} 53..54 0/1 (0%)
Glutathione binding. {ECO:0000250} 66..67 0/1 (0%)
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 27/71 (38%)
GstA 6..201 CDD:223698 61/205 (30%)
GST_C_Delta_Epsilon 92..210 CDD:198287 29/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C91903638
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.