DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tyro3 and dpr10

Sequence 1:NP_058788.1 Gene:Tyro3 RGDID:3923 Length:880 Species:Rattus norvegicus
Sequence 2:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster

Alignment Length:305 Identity:61/306 (20%)
Similarity:95/306 (31%) Gaps:94/306 (31%)


  Rat    39 PVKMTVSQGQPVKLNCSVEGMDDPDIHWMKD--------GAVVQNAS---QVSISISEQNWIGLL 92
            |..:|...|:...|.|.|:.:.:..:.|::.        |.......   |.|.......|  .|
  Fly    60 PRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEW--TL 122

  Rat    93 SLKSAERSDAGLYWCQVK-----------------DGEETKISQSVW------------------ 122
            .:|.|::.|||:|.||:.                 |.|.:.|.|..:                  
  Fly   123 QIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAETSDIMQQYYNDDAFYIAENRVYQSSND 187

  Rat   123 --------LTVEGVPFFTV-EPKDLAVPPNVPFQLSCEAVGPPEPVTIFWWRGPTKV------GG 172
                    :....||..|: ...||.|.......|:|.....|||.|..:|....||      ||
  Fly   188 EFAGMFGPIQTVAVPTATILGGPDLYVDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGG 252

  Rat   173 --------PASSPSVLNV--TGVTQRTEFSCEAHN-------IKGLATSRPAIIRLQAPPAA--- 217
                    ...:.|:|.:  ..:....::||...|       :..|...||..::..|.|||   
  Fly   253 RLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSNTEIASIRVHVLQGERPEAMQTNAAPAAVAL 317

  Rat   218 -----PFNITVTTISSSNASVAWVPGADGLALLHSCTVQVAHAPG 257
                 .|......:...:..||      .|.||.:|:..:..:.|
  Fly   318 ACWSCHFGQATQAVRVISTMVA------ALVLLEACSSLLLQSGG 356

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tyro3NP_058788.1 IG_like 39..125 CDD:214653 24/140 (17%)
IGc2 46..111 CDD:197706 18/93 (19%)
Ig2_Tyro3_like 131..209 CDD:143226 23/102 (23%)
IG_like 135..204 CDD:214653 20/92 (22%)
FN3 215..307 CDD:238020 11/52 (21%)
fn3 315..396 CDD:278470
PTKc_Tyro3 498..781 CDD:270659
Pkinase_Tyr 508..776 CDD:285015
dpr10NP_729591.1 Ig 63..143 CDD:299845 19/82 (23%)
IG_like 210..297 CDD:214653 19/87 (22%)
IGc2 217..287 CDD:197706 15/70 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.