DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FUS and fus

DIOPT Version :8

Sequence 1:NP_004951.1 Gene:FUS / 2521 HGNCID:4010 Length:526 Species:Homo sapiens
Sequence 2:NP_957377.2 Gene:fus / 394058 ZFINID:ZDB-GENE-040426-1010 Length:541 Species:Danio rerio

Alignment Length:576 Identity:357/577 (62%)
Similarity:398/577 (69%) Gaps:85/577 (15%)


Human     1 MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSG--YGQSSYSS-YGQSQ 62
            ||||||.|.::..||.|..|.||.|||.|:|.|.||||.||:||:::|.  |.|..||| |||||
Zfish     1 MASNDYGQTSSHGYGGYGGQSGQSYSQPSAQNYSQQSYGGYNQSSESSSAPYNQGGYSSNYGQSQ 65

Human    63 NTGYGTQSTPQGYG------STGGYGSSQ----SSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSS 117
            :.|||:|:..|||.      |:|||.::.    :....|.|||||.||.|. :|:|..|.|.|||
Zfish    66 SGGYGSQAPSQGYSQSSQSYSSGGYSNTSQPPPAQSGGYSQQSSYSGYNQS-SPASAPGGYSSSS 129

Human   118 QSSSYGQPQ-------SGSYSQQPSY-------------GGQQQ-------SYGQQQSYN--PPQ 153
            |||.|||.|       .||..|...|             |||.|       ||....:|:  |||
Zfish   130 QSSGYGQQQQQSGGGYGGSGGQSGGYGSSGGQSSGFGGSGGQHQSSQSGGGSYSPSPNYSSPPPQ 194

Human   154 GYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGR 218
            .||||:||           |.|.|.||...| ||||.|||||.||       |||.|..||||||
Zfish   195 SYGQQSQY-----------GQGGYNQDSPPM-SGGGGGGGYGGQD-------GGYSQDGRGGRGR 240

Human   219 GGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGS--RHDSEQDN 281
            |  ||.||.|.||::|.       ||||.| ||||||..|||||||||||||.|:  .:..||||
Zfish   241 G--GGFGGRGAGGFDRG-------GRGGPR-GRGGMGMGDRGGFNKFGGPRDHGAGGPNMQEQDN 295

Human   282 SDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPS 346
            ||||||||||||::.|::|||||||||||||.|||||.|||||||||||||||||||||||||||
Zfish   296 SDNNTIFVQGLGDDYTVDSVADYFKQIGIIKVNKKTGLPMINLYTDRETGKLKGEATVSFDDPPS 360

Human   347 AKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNG--RGGRGRGGPMGRGGYGGGGSGGGGRGG 409
            |||||||||||:|:|||||||||||||:|.|||.:|  ||||||||||||||:|||..||||.||
Zfish   361 AKAAIDWFDGKDFNGNPIKVSFATRRAEFGRGGSSGGMRGGRGRGGPMGRGGFGGGRGGGGGGGG 425

Human   410 FP----SGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGD 470
            |.    .|.|.||||||||||||.||:|.|:||||||||||||.|||:|.|||.  |.|||.:|.
Zfish   426 FQGNNGGGSGNGGGQQRAGDWKCSNPSCGNLNFSWRNECNQCKEPKPEGSGGGM--SPMGGGFGG 488

Human   471 DRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY 526
            :|  ||.|:||||:|||||||||||||| ||||||||||||||||:||.|||:|||
Zfish   489 ER--GRSGFDRGGFRGRGGDRGGFRGGR-GGDRGGFGPGKMDSRGDHRHDRRDRPY 541

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FUSNP_004951.1 RRM_FUS_TAF15 283..368 CDD:240979 76/85 (89%)
zf-RanBP 422..449 CDD:279035 23/27 (85%)
fusNP_957377.2 RRM <274..>388 CDD:223796 97/114 (85%)
RRM_FUS_TAF15 297..382 CDD:240979 76/85 (89%)
zf-RanBP 443..472 CDD:279035 24/29 (83%)
RanBP2-type Zn finger 446..467 CDD:275375 17/21 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C309114614
eggNOG 1 0.900 E1_KOG1995
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 655 1.000 Inparanoid score I4625
OMA 1 1.010
OrthoDB 1 1.010 D1539664at2759
OrthoFinder 1 1.000 FOG0002470
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_131954
Panther 1 1.100 LDO PTHR23238
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4499
TreeFam 1 0.960
ZFIN 1 1.500
1212.390

Return to query results.
Submit another query.