DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: FUS and caz

Sequence 1:NP_004951.1 Gene:FUS HGNCID:4010 Length:526 Species:Homo sapiens
Sequence 2:NP_523365.2 Gene:caz FlyBaseID:FBgn0285954 Length:399 Species:Drosophila melanogaster

Alignment Length:461 Identity:195/462 (42%)
Similarity:235/462 (51%) Gaps:110/462 (24%)


Human   111 GSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYN-PPQGYGQQNQYNSSSGGGGGGGGG 174
            |.||..|     ||..:......|:|   ||...:..:|| ||..||:|        |||...|.
  Fly     4 GGYGGGS-----GQGYNNFAVPPPNY---QQMPNKTGNYNEPPPNYGKQ--------GGGYDSGS 52

Human   175 GNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGY 239
            |:.|      |.|.|:||        |||||    ..|||    |.|.|.||.....||:..|||
  Fly    53 GHRG------SGGSGNGG--------GGGGS----WNDRG----GNSYGNGGASKDSYNKGHGGY 95

Human   240 EPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADY 304
            ...|.|||.||.||.||:|.                     .:..:||||.|:..:.|.:.:..:
  Fly    96 SGGGGGGGGGGGGGSGGNDM---------------------ITQEDTIFVSGMDPSTTEQDIETH 139

Human   305 FKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFA 369
            |..|||||.:|:|.:|.|.||.::|||..||||||::||..:|::||:||||::|:||.||||.|
  Fly   140 FGAIGIIKKDKRTMKPKIWLYKNKETGASKGEATVTYDDTNAAQSAIEWFDGRDFNGNAIKVSLA 204

Human   370 TRRADFNRGGGNGRGGRGRGGPMG-RGGYGGGGSGGGGRGGFPSGGGGGGG-------------- 419
            .|:.::|:|||.|.||.||||..| |||.||||.||||.|.|..|||||||              
  Fly   205 QRQNNWNKGGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGG 269

Human   420 ---QQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDR 481
               |.|.|||||  .:|.|.||:||||||:||.||.|..|...||.  ||.||..  ||.|||||
  Fly   270 GNVQPRDGDWKC--NSCNNTNFAWRNECNRCKTPKGDDEGSSGGGG--GGGYGGG--GGGGGYDR 328

Human   482 GGYRGRGG------DRGG-FRGGRGGG----------DRGGFGPGKMDSRGEHRQD--------- 520
            |..||.||      |||| .:||.|||          |..|.|.|.....|.:|:|         
  Fly   329 GNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNGGGRGGRGGGGGNRRDGGPMRNDGG 393

Human   521 RRERPY 526
            .|.|||
  Fly   394 MRSRPY 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FUSNP_004951.1 RRM_FUS_TAF15 283..368 CDD:240979 43/85 (51%)
zf-RanBP 422..449 CDD:279035 18/27 (67%)
cazNP_523365.2 RRM <118..>205 CDD:223796 44/87 (51%)
RRM_SARFH 122..204 CDD:240978 42/82 (51%)
zf-RanBP 275..304 CDD:279035 20/31 (65%)
RanBP2-type Zn finger 279..298 CDD:275375 13/21 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1995
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 295 1.000 Inparanoid score I2706
Isobase 1 0.950 0 Normalized mean entropy S1093
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1539664at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_131954
Panther 1 1.100 O PTHR23238
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4499
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.