DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FUS and Fus

DIOPT Version :8

Sequence 1:NP_004951.1 Gene:FUS / 2521 HGNCID:4010 Length:526 Species:Homo sapiens
Sequence 2:NP_631888.1 Gene:Fus / 233908 MGIID:1353633 Length:518 Species:Mus musculus

Alignment Length:529 Identity:503/530 (95%)
Similarity:504/530 (95%) Gaps:14/530 (3%)


Human     1 MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSY-SSYGQSQNT 64
            |||||||||||||||||||||||||||||||||||||||||.||.|||||||||| |||||:|||
Mouse     1 MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYGQSADTSGYGQSSYGSSYGQTQNT 65

Human    65 GYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGS 129
            ||||||.|||||||||||||||||||||||||||||||||||||||||||.|||||||||||||.
Mouse    66 GYGTQSAPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGGSSQSSSYGQPQSGG 130

Human   130 YSQQPSYGGQQQSYGQQQ-SYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGG 193
            |.||..|||||||||||| |||||||||||||||||| |||||||||||||||||| ||||.|||
Mouse   131 YGQQSGYGGQQQSYGQQQSSYNPPQGYGQQNQYNSSS-GGGGGGGGGNYGQDQSSM-SGGGGGGG 193

Human   194 YGNQDQSGGGGSG-GYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGS 257
            |||||||||||.| |.||||||||||        |||||||||||||||||||||||||||||||
Mouse   194 YGNQDQSGGGGGGYGGGQQDRGGRGR--------GGGGGYNRSSGGYEPRGRGGGRGGRGGMGGS 250

Human   258 DRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMI 322
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   251 DRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMI 315

Human   323 NLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRG 387
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   316 NLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRG 380

Human   388 RGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKP 452
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse   381 RGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKP 445

Human   453 DGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEH 517
            ||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||
Mouse   446 DGPGGGPGGSHMGGNYGDDRR-GRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEH 509

Human   518 RQDRRERPY 526
            |||||||||
Mouse   510 RQDRRERPY 518

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FUSNP_004951.1 RRM_FUS_TAF15 283..368 CDD:240979 85/85 (100%)
zf-RanBP 422..449 CDD:279035 27/27 (100%)
FusNP_631888.1 RRM <257..>367 CDD:223796 110/110 (100%)
RRM_FUS_TAF15 276..361 CDD:240979 85/85 (100%)
zf-RanBP 415..442 CDD:279035 27/27 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C308805503
eggNOG 1 0.900 E1_KOG1995
HGNC 1 1.500
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 1047 1.000 Inparanoid score I5305
Isobase 1 0.950 0 Normalized mean entropy S1093
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002470
OrthoInspector 1 1.000 T2454618
orthoMCL 1 0.900 OOG5_131954
Panther 1 1.100 LDO PTHR23238
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4499
TreeFam 1 0.960
1414.240

Return to query results.
Submit another query.