DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FUS and fust-1

DIOPT Version :8

Sequence 1:NP_004951.1 Gene:FUS / 2521 HGNCID:4010 Length:526 Species:Homo sapiens
Sequence 2:NP_495483.1 Gene:fust-1 / 174175 WormBaseID:WBGene00016173 Length:448 Species:Caenorhabditis elegans

Alignment Length:513 Identity:184/514 (36%)
Similarity:221/514 (43%) Gaps:166/514 (32%)


Human    56 SSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSS 120
            ::|.|||    ...|||:|                   |.:|..|.||            ..|..
 Worm     2 AAYDQSQ----PDYSTPEG-------------------QQAYWAYYQQ------------QQQQQ 31

Human   121 SYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPP----QGYGQQNQYNSSSGGGGGGGGGGNYGQDQ 181
            ..|||....|: ..:|||..|:...|..|.||    ..|||        |.||..||...|||  
 Worm    32 PGGQPDQDPYA-AAAYGGHDQAQQPQNPYAPPPPGADPYGQ--------GSGGQSGGSDPYGQ-- 85

Human   182 SSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGG 246
               |.|||.||..|::   ||||..|         |||||.||..||.|||....|     ||||
 Worm    86 ---SRGGGRGGFGGSR---GGGGYDG---------GRGGSRGGYDGGRGGYGGDRG-----GRGG 130

Human   247 GRGGRGG--MGGS--DRGGFNKFGGP-------RDQGSRHD----------------SEQDNSD- 283
            ||||..|  .|||  |.|..::.|||       :|:|.|.|                :.:..|| 
 Worm   131 GRGGYDGERRGGSRWDDGNSDRQGGPPGGRGGYQDRGPRRDGPPSGGGYGGGGAASGNREFGSDG 195

Human   284 ----NNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDP 344
                ..|:||||:........:||.|...|.|..|.:  .|.|.:||||.||:.|||..::|.|.
 Worm   196 RVELKETVFVQGISTTANEAYIADVFSTCGDIAKNDR--GPRIKIYTDRNTGEPKGECMITFVDA 258

Human   345 PSAKAAIDWFDGKEFSG--NPIKVSFATRRADF--NRGGGNGRG--GRGRGGPM-GRGGYG---G 399
            .:|:.||..::|:.|.|  :|:.:|.|..|||.  .|||..|||  |.|||||| ||||:|   |
 Worm   259 SAAQQAITMYNGQPFPGGSSPMSISLAKFRADAGGERGGRGGRGGFGGGRGGPMGGRGGFGGDRG 323

Human   400 GGSGGGGRGGFPSGGGGGGG--------------------------------------------- 419
            |..||||||||..|.|||||                                             
 Worm   324 GYGGGGGRGGFDGGRGGGGGFRGGDRGGFRGGDRGGFRGGDRGGFRGGDRGGDRGGFRGGRGVGG 388

Human   420 -----QQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDR 472
                 :||..||.|..  |.|.||::|.|||||:||:|||..||.||...||..|.||
 Worm   389 GNANMEQRKNDWPCEQ--CGNSNFAFRRECNQCQAPRPDGGSGGGGGERRGGPPGGDR 444

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FUSNP_004951.1 RRM_FUS_TAF15 283..368 CDD:240979 33/92 (36%)
zf-RanBP 422..449 CDD:279035 14/27 (52%)
fust-1NP_495483.1 RRM <202..>290 CDD:223796 35/90 (39%)
RRM_FET 203..284 CDD:240726 31/83 (37%)
ZnF_RBZ 398..421 CDD:197784 13/25 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 218 1.000 Inparanoid score I2578
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_131954
Panther 1 1.100 O PTHR23238
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.