DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FUS and fus

DIOPT Version :8

Sequence 1:NP_004951.1 Gene:FUS / 2521 HGNCID:4010 Length:526 Species:Homo sapiens
Sequence 2:XP_012809196.1 Gene:fus / 100038234 XenbaseID:XB-GENE-495119 Length:554 Species:Xenopus tropicalis

Alignment Length:586 Identity:411/587 (70%)
Similarity:441/587 (75%) Gaps:92/587 (16%)


Human     1 MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSY-SSYGQSQNT 64
            ||:|||:|||:|.|||||:||.|||.||.||.|.||.||||.||...|.||||.| |||||.|:.
 Frog     1 MATNDYSQQASQGYGAYPSQPSQGYGQQGSQSYSQQGYSGYGQSAGGSSYGQSGYSSSYGQDQSA 65

Human    65 GYGTQSTPQGYGSTGGYGSSQSSQSSYG-------QQSSYPGYGQQPAPSSTSGSYGSSSQSSSY 122
            ||.:||||||||| ||||:||||||.||       .||||..|.|||..||.:|||..|||.|||
 Frog    66 GYSSQSTPQGYGS-GGYGNSQSSQSPYGSGQPQQQSQSSYSSYSQQPPASSNTGSYSGSSQPSSY 129

Human   123 GQPQSGSYSQQP---------SYGGQQQ------------------SYGQQQ--SYNPPQGYG-Q 157
            .|.|||.|.|||         |||||||                  ||||||  ||:.||||| |
 Frog   130 QQQQSGGYGQQPSGGYGSQQSSYGGQQQSSYGSQQGQSGYGSQQPSSYGQQQQSSYSQPQGYGQQ 194

Human   158 QNQYNSSSGGGGGGGG---------GGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDR 213
            |.||:         ||         .|.|.||..||.|     |.||     ||...||||.|||
 Frog   195 QTQYS---------GGVPDVYDLFPAGGYNQDSPSMGS-----GSYG-----GGSDQGGYGGQDR 240

Human   214 GGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGS--RHD 276
             ||||||.||.|||||||    :||::.||| |.|||||||||.:||||:||||||:.|.  ||:
 Frog   241 -GRGRGGFGGRGGGGGGG----AGGFDSRGR-GSRGGRGGMGGGERGGFSKFGGPREGGGPPRHE 299

Human   277 -SEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVS 340
             :||||||||||||||||||||:||||||||||||||||||||||||||||||||||||||||||
 Frog   300 MAEQDNSDNNTIFVQGLGENVTVESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVS 364

Human   341 FDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFN-RGGGNGRG-GRGRGGPMGRGGYGG--GG 401
            |||||||||||||||||||||||||||||||||||| |||||||| ||| ||||||||:||  ||
 Frog   365 FDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNSRGGGNGRGRGRG-GGPMGRGGFGGPPGG 428

Human   402 SGG-GGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMG 465
            ||. ||.||:||   ||||||||||||||||:||||||||||||||||||||:|| |||||||||
 Frog   429 SGSRGGSGGYPS---GGGGQQRAGDWKCPNPSCENMNFSWRNECNQCKAPKPEGP-GGPGGSHMG 489

Human   466 GN-----YGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERP 525
            |:     :||:|||||||:||||:|||||||||||||| ||||||||||||||||:||||||:||
 Frog   490 GDVIAGGFGDERRGGRGGFDRGGFRGRGGDRGGFRGGR-GGDRGGFGPGKMDSRGDHRQDRRDRP 553

Human   526 Y 526
            |
 Frog   554 Y 554

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FUSNP_004951.1 RRM_FUS_TAF15 283..368 CDD:240979 84/85 (99%)
zf-RanBP 422..449 CDD:279035 26/27 (96%)
fusXP_012809196.1 RRM <298..>398 CDD:223796 96/100 (96%)
RRM_FUS_TAF15 307..392 CDD:240979 84/85 (99%)
zf-RanBP 447..474 CDD:279035 26/27 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C309027512
eggNOG 1 0.900 E1_KOG1995
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 761 1.000 Inparanoid score I4357
OMA 1 1.010
OrthoDB 1 1.010 D1539664at2759
OrthoFinder 1 1.000 FOG0002470
OrthoInspector 1 1.000 T1889081
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4499
TreeFam 1 0.960
109.890

Return to query results.
Submit another query.