DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ccnb1 and CycA

Sequence 1:NP_741988.1 Gene:Ccnb1 RGDID:2291 Length:423 Species:Rattus norvegicus
Sequence 2:NP_524030.2 Gene:CycA FlyBaseID:FBgn0000404 Length:491 Species:Drosophila melanogaster

Alignment Length:467 Identity:119/468 (25%)
Similarity:202/468 (43%) Gaps:103/468 (22%)


  Rat    12 NTENKAKVSMAGAK--RVPVAVAASKPLLRSRTALGDIGNKVSEQSRIPLKKETKKLGSGTVTVK 74
            |.||......||.|  :.|:||               ||.|..:.:..|........|:..|   
  Fly    12 NKENPGIKIPAGVKNTKQPLAV---------------IGGKAEKNALAPRANFAVLNGNNNV--- 58

  Rat    75 ALPKPVDKVPVCEPEVELDEPEPEPVMEVKHSPEPILVDTPSPSPMETSG---CAPA-------- 128
              |:|..||.|......|:..|.......|.:..|::....:.|..|.:.   .||:        
  Fly    59 --PRPAGKVQVFRDVRNLNVDENVEYGAKKSNVVPVVEQFKTFSVYEDNNDTQVAPSGKSLASLV 121

  Rat   129 -------------EEYLCQAFSDVILAVSDVDADDGGDPNLCS---------------------- 158
                         :|.:........::|:||.:....|.::..                      
  Fly   122 DKENHDVKFGAGQKELVDYDLDSTPMSVTDVQSPMSVDRSILGVIQSSDISVGTETGVSPTGRVK 186

  Rat   159 ---------------EYVKDIYAYLRQLEEEQSVRPKYL-LGREVTGNMRAILIDWLIQVQMKFR 207
                           :|..||..|.|:.|::...:|.|: ..::::.|||:||||||::|..:::
  Fly   187 ELPPRNDRQRFLEVVQYQMDILEYFRESEKKHRPKPLYMRRQKDISHNMRSILIDWLVEVSEEYK 251

  Rat   208 LLQETMYMTVSIIDRFMQDSCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTNNTYTKHQI 272
            |..||:|::|..:|||:....|.:..|||||..||:||:||||:||||:|:|.|:|:::|||.|:
  Fly   252 LDTETLYLSVFYLDRFLSQMAVVRSKLQLVGTAAMYIAAKYEEIYPPEVGEFVFLTDDSYTKAQV 316

  Rat   273 RQMEMKILRVLNFSLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELSMLDYD-MVHFAPSQIAA 336
            .:||..||::|:|.|..|....|:...:.:.::..:...:..|:.|||:::.: .:.:.||.:::
  Fly   317 LRMEQVILKILSFDLCTPTAYVFINTYAVLCDMPEKLKYMTLYISELSLMEGETYLQYLPSLMSS 381

  Rat   337 GAFCLALKILDNGEWTPTLQHYLSHTEESLLPVMQHLAKNIVMVNRGLTKHMTIK--------NK 393
            .:..||..||....|||.|:...::..|.|..|:.||...          |.|.|        .|
  Fly   382 ASVALARHILGMEMWTPRLEEITTYKLEDLKTVVLHLCHT----------HKTAKELNTQAMREK 436

  Rat   394 YATSKHAKISTL 405
            |....:.|::.:
  Fly   437 YNRDTYKKVAMM 448

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ccnb1NP_741988.1 Interaction with CDK2. {ECO:0000250} 159..167 3/8 (38%)
Cyclin_N 163..288 CDD:278560 58/126 (46%)
Interaction with CDK2. {ECO:0000250} 248..251 3/3 (100%)
Cyclin_C 290..408 CDD:281044 27/126 (21%)
CycANP_524030.2 Cyclin_N 206..332 CDD:278560 58/126 (46%)
Cyclin_C 334..450 CDD:281044 27/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C96075242
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D993640at2759
OrthoFinder 1 1.000 FOG0000124
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.