DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gucy1b1 and Gyc89Db

Sequence 1:NP_036901.2 Gene:Gucy1b1 RGDID:2769 Length:619 Species:Rattus norvegicus
Sequence 2:NP_650551.1 Gene:Gyc89Db FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster

Alignment Length:691 Identity:200/692 (29%)
Similarity:321/692 (46%) Gaps:113/692 (16%)


  Rat     1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDE--EGQFLVRIIYDDSKTYDLVAAASKVLNLNA 63
            |||.:..:::..:.:.||.|.|   :|..|:.:  ...|....||.|....|..||    |:.:.
  Fly     1 MYGMLYESVQHYIQQEYGMETW---RKVCQIVDCKHQSFKTHQIYPDKLMPDFAAA----LSAST 58

  Rat    64 GE----ILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTD 124
            ||    .:..||:.|..|....|||.::|..|....:|||::|.:|..:...||.|::||.:.|:
  Fly    59 GESFDFCMNFFGRCFVRFFSNFGYDKMIRSTGRYFCDFLQSIDNIHVQMRFTYPKMKSPSMQLTN 123

  Rat   125 AEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRSEECDHTQFLIEEKESKEE 189
            .: ..|.::.|.|.|.|:...:||.:..||::.:|.::...|::.:::.|..|...|:..|....
  Fly   124 MD-DDGAVILYRSGRTGMSKYLIGQMTEVAKEFYGLDMTAYVLESQNDICGGTAGPIKLTEGPLT 187

  Rat   190 DFYEDLDRFEENGTQDSRISPY--------------TFCKAFPFHIIFDRDLVVTQCGNAIYRVL 240
            ...:....|:.......|::..              .|.:.|||.|:.|.|:.:|..|..|....
  Fly   188 VIVKYRLDFDNRDYMAKRVNVIAHPSQLKMPSVDLNVFLELFPFTIVLDHDMKITLAGEKIVETW 252

  Rat   241 PQLQPG---------------KC-----------------SLLSVFSLVRP-H--------IDIS 264
            ....||               ||                 ::|..|.|:|. |        ::..
  Fly   253 ILHNPGVNPKTFIGSHILERFKCRRPKDTQIQWETILQMRTVLFEFELIRTGHNRAAYDAALNFD 317

  Rat   265 FHGI-----LSHINTVFVLRSKEGLLDVEKLEC------EDEL---TGAE-----ISCLRLKGQM 310
            |...     |:....:.:..:||...:..|.|.      :||:   ||..     :..:.|||||
  Fly   318 FENFDEASSLNEAQAMALASAKEFSAENAKEEAAAAATSKDEIDPATGQRRHSVGLRSILLKGQM 382

  Rat   311 IYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEIL--- 372
            .|:.:.||::|||||.:.|||:|...||||:|:..|..:|:||:.|.|.      ..:|||:   
  Fly   383 FYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGLSRELVMAGWQH------CSKLEIMFEK 441

  Rat   373 ----TDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAF 433
                :|.|:.:|...:..|::.|.||||::|..:|..:|.......:.::.|:::|..::  |.:
  Fly   442 EEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMRKSEEHVCQSFEEVSVIFIEVM--NIY 504

  Rat   434 CSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICH 498
            .|...:.:.||:.|..||.:   |..|.:...:||||||||||..||.|||.|:....||...|.
  Fly   505 DSGSNNIQDAMQAVTTLNKV---FSALDEEIISPFVYKVETVGMVYMAVSGAPDVNPLHAEHACD 566

  Rat   499 LALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKIN 563
            |||.:|:......:.|  |.|.:||::|.||.||:|.::|||||||:|||..||.|::.:...|.
  Fly   567 LALRVMKKVKAHALPG--VAIRVGINSGPVVAGVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQ 629

  Rat   564 VSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFL 604
            :|.||     :.:.....:.:|.||.|.:|||.|....|.|
  Fly   630 LSNYT-----ALKVQKVGYKVEARGFVKVKGKGEMETYWLL 665

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gucy1b1NP_036901.2 HNOB 2..166 CDD:285002 48/170 (28%)
HNOBA 207..406 CDD:285003 72/280 (26%)
CYCc 385..584 CDD:214485 71/199 (36%)
Guanylate_cyc 412..605 CDD:278633 72/194 (37%)
Gyc89DbNP_650551.1 HNOB 2..161 CDD:285002 48/167 (29%)
HNOBA 218..479 CDD:285003 71/267 (27%)
CYCc 460..646 CDD:214485 71/198 (36%)
Guanylate_cyc 488..665 CDD:278633 71/189 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D245586at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.