DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pen-2 and psenen

DIOPT Version :9

Sequence 1:NP_001286566.1 Gene:pen-2 / 251430 FlyBaseID:FBgn0053198 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001016336.1 Gene:psenen / 549090 XenbaseID:XB-GENE-854651 Length:101 Species:Xenopus tropicalis


Alignment Length:99 Identity:55/99 - (55%)
Similarity:73/99 - (73%) Gaps:0/99 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDISKAPNPRKLELCRKYFFAGFAFLPFVWAINVCWFFTEAFHKPPFSEQSQIKRYVIYSAVGTL 65
            |::.:.||..||:|||||:..|||.|||:|.:||.|||.|||.||.::||..|:.||..||:|..
 Frog     1 MNLERVPNEEKLQLCRKYYLGGFALLPFLWLVNVVWFFKEAFFKPAYTEQPLIQSYVKRSALGLF 65

  Fly    66 FWLIVLTAWIIIFQTNRTAWGATADYMSFIIPLG 99
            .|:::||.||.::||:|..||||.||:||.||||
 Frog    66 VWVVILTTWISVYQTHRAGWGATGDYLSFTIPLG 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pen-2NP_001286566.1 PEN-2 7..99 CDD:402042 52/91 (57%)
psenenNP_001016336.1 PEN-2 7..99 CDD:402042 52/91 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5250
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H11952
Inparanoid 1 1.050 134 1.000 Inparanoid score I4464
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1517974at2759
OrthoFinder 1 1.000 - - FOG0006355
OrthoInspector 1 1.000 - - oto102856
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2718
SonicParanoid 1 1.000 - - X5308
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.