DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pen-2 and psenen

DIOPT Version :8

Sequence 1:NP_001286566.1 Gene:pen-2 / 251430 FlyBaseID:FBgn0053198 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001016336.1 Gene:psenen / 549090 XenbaseID:XB-GENE-854651 Length:101 Species:Xenopus tropicalis

Alignment Length:99 Identity:55/100 (55%)
Similarity:73/100 (73%) Gaps:0/100 (0%)


  Fly     1 MDISKAPNPRKLELCRKYFFAGFAFLPFVWAINVCWFFTEAFHKPPFSEQSQIKRYVIYSAVGTL 65
            |::.:.||..||:|||||:..|||.|||:|.:||.|||.|||.||.::||..|:.||..||:|..
 Frog     1 MNLERVPNEEKLQLCRKYYLGGFALLPFLWLVNVVWFFKEAFFKPAYTEQPLIQSYVKRSALGLF 65

  Fly    66 FWLIVLTAWIIIFQTNRTAWGATADYMSFIIPLG 99
            .|:::||.||.::||:|..||||.||:||.||||
 Frog    66 VWVVILTTWISVYQTHRAGWGATGDYLSFTIPLG 99

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pen-2NP_001286566.1 PEN-2 7..99 CDD:287253 53/92 (58%)
psenenNP_001016336.1 PEN-2 7..99 CDD:313477 53/92 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C217714109
eggNOG 1 0.900 E1_KOG3402
Hieranoid 1 1.000
Homologene 1 1.000 H11952
Inparanoid 1 1.050 134 1.000 Inparanoid score I4343
OMA 1 1.010
OrthoDB 1 1.010 D1517974at2759
OrthoFinder 1 1.000 FOG0006473
OrthoInspector 1 1.000 T1059263
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2718
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.