DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Chrnb4 and nAChRbeta1

Sequence 1:NP_434693.1 Gene:Chrnb4 RGDID:2351 Length:495 Species:Rattus norvegicus
Sequence 2:NP_523927.2 Gene:nAChRbeta1 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster

Alignment Length:505 Identity:212/506 (42%)
Similarity:310/506 (61%) Gaps:33/506 (7%)


  Rat     6 LLLVSLFSLLQDGDCRLANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIRLELSLSQLISVNER 70
            :|::..|||:.     .:..||:|:.||..  .||.||||..:.:|.:.:|..|:..|||:|||:
  Fly    13 ILVLVAFSLVS-----ASEDEERLVRDLFR--GYNKLIRPVQNMTQKVGVRFGLAFVQLINVNEK 70

  Rat    71 EQIMTTSIWLKQEWTDYRLAWNSSCYEGVNILRIPAKRVWLPDIVLYNNADGTYEVSVYTNVIVR 135
            .|||.:::||:..|.||:|.|:.:.|.|:.:||:|..:||.|||||:|||||.|||...:||::.
  Fly    71 NQIMKSNVWLRLVWYDYQLQWDEADYGGIGVLRLPPDKVWKPDIVLFNNADGNYEVRYKSNVLIY 135

  Rat   136 SNGSIQWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDHTEIDMVLKSPTAIMD--DFTPSG 198
            ..|.:.|:|||||:|:|.|:|.:||||||.|.:||.|||::..::.:.|.:....:|  |:..||
  Fly   136 PTGEVLWVPPAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFNGDQVSLALYNNKNFVDLSDYWKSG 200

  Rat   199 EWDIVALPGRRTVNPQD---PSYVDVTYDFIIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCG 260
            .|||:.:|....|...|   |:..|:|:..||:||.||||:|||:|.|||:.|.:||||||::.|
  Fly   201 TWDIIEVPAYLNVYEGDSNHPTETDITFYIIIRRKTLFYTVNLILPTVLISFLCVLVFYLPAEAG 265

  Rat   261 EKMTLCISVLLALTFFLLLISKIVPPTSLDIPLIGKYLLFTMVLVTFSIVTTVCVLNVHHRSPST 325
            ||:||.||:||:|..||||:|||:|||||.:|||.||||||.::.|.||:.||.::|.:.|.|.|
  Fly   266 EKVTLGISILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIMNTVSILVTVIIINWNFRGPRT 330

  Rat   326 HTMASWVKECFLHKLPTFLFMKRPG-------LE---VSLVRVPHPSQLHLATADTAATSALGPT 380
            |.|..:::..|||.||.|||||||.       :|   :|:...||||....|......::..|..
  Fly   331 HRMPMYIRSIFLHYLPAFLFMKRPRKTRLRWMMEMPGMSMPAHPHPSYGSPAELPKHISAIGGKQ 395

  Rat   381 SP------SNLYGSSMYFVNPVPAAPKSAVSSHTAGLPRDARLRSSGRFREDLQEALEGVSFIAQ 439
            |.      |:|:..:......|.:..:..:..   |..|::....|.....:..:|.|.|.|||:
  Fly   396 SKMEVMELSDLHHPNCKINRKVNSGGELGLGD---GCRRESESSDSILLSPEASKATEAVEFIAE 457

  Rat   440 HLESDDRDQSVIEDWKFVAMVVDRLFLWVFVFVCILGTMGLFL--PPLFQ 487
            ||.::|......||||:||||:|||.|::|..|...||:|:.:  |.:|:
  Fly   458 HLRNEDLYIQTREDWKYVAMVIDRLQLYIFFIVTTAGTVGILMDAPHIFE 507

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Chrnb4NP_434693.1 LIC 21..483 CDD:273305 206/485 (42%)
Neur_chan_LBD 26..231 CDD:280998 93/210 (44%)
Neur_chan_memb 238..481 CDD:280999 108/259 (42%)
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 210/497 (42%)
Neur_chan_LBD 28..236 CDD:280998 93/210 (44%)
Neur_chan_memb 243..498 CDD:280999 108/258 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D188416at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.