DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vars and GstD2

Sequence 1:NP_445744.1 Gene:Vars RGDID:3950 Length:1264 Species:Rattus norvegicus
Sequence 2:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster

Alignment Length:180 Identity:40/181 (22%)
Similarity:62/181 (34%) Gaps:46/181 (25%)


  Rat    53 PPPRLPALEQGPGGLWVWGAPAVA-----------QLLWPAGLGGPGGSRAAVLVQQWVSYADTE 106
            |...:|.|..  .|..:|.:.|:|           .||       |...:...::.|.:.:....
  Fly    48 PQHTIPTLVD--NGFSIWESRAIAVYLVEKYGKDDYLL-------PNDPKKRAVINQRLYFDMGT 103

  Rat   107 LTPAACGATLPALGLRGPGQDPQAALGALGKALNPLEEWLRLHTYLAGDAPTLADLAAVTALLLP 171
            |..:......|......||.|..  |..:..|...|:.:|....|:|||..|:||:|.::.:...
  Fly   104 LYESFAKYYYPLFRTGKPGSDED--LKRIETAFGFLDTFLEGQEYVAGDQLTVADIAILSTVSTF 166

  Rat   172 FRYVLDPSARRIWGNVTRWFNTCVRQPEFRAVLGEVVLYSGARSVTQQPG 221
            .....|.|.   :.||:||                   |..|:.||  ||
  Fly   167 EVSEFDFSK---YSNVSRW-------------------YDNAKKVT--PG 192

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VarsNP_445744.1 GstA <56..203 CDD:223698 33/158 (21%)
GST_C_family 92..213 CDD:295467 25/121 (21%)
PTZ00419 282..1264 CDD:240411
ValRS_core 335..938 CDD:185677
'HIGH' region 344..354
tRNA-synt_1_2 513..640 CDD:290334
'KMSKS' region 862..866
Anticodon_Ia_Val 938..1075 CDD:153416
Val_tRNA-synt_C 1196..1258 CDD:287436
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 7/28 (25%)
GST_C_Delta_Epsilon 88..204 CDD:198287 30/132 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.