DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dnajb9 and CG5001

Sequence 1:NP_036831.2 Gene:Dnajb9 RGDID:3070 Length:222 Species:Rattus norvegicus
Sequence 2:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster

Alignment Length:217 Identity:75/218 (34%)
Similarity:102/218 (47%) Gaps:42/218 (19%)


  Rat    25 KNYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDII 89
            |:||.|||:||:|::.:||||:.|||::|||||||:.:||.||:|:|||||.|||.::|:.||..
  Fly     3 KDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKY 67

  Rat    90 GHSAFTNGKGQRSNGSPFEQSFNFNFDD----LFKDF--------NLFGQNQNTRSKKHF----E 138
            |.....:| |.| ||.|...||.:.|..    .|..|        :.|....|...||.|    |
  Fly    68 GEDGLKSG-GTR-NGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTE 130

  Rat   139 NHFQTRQDGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSF---SGFDSTNRRT--------VQTE 192
            ..|.:...|....||     ..|.|     |....:..||   :.|....::.        |..|
  Fly   131 PDFFSSPFGGIGSRH-----GLGSG-----FRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLE 185

  Rat   193 NRFHG---SSKHCRTVTQRRGN 211
            ..:||   ..|..|.:.|..|:
  Fly   186 EIYHGCVKKMKISRRIVQADGS 207

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dnajb9NP_036831.2 DnaJ 26..87 CDD:278647 37/61 (61%)
Divergent targeting domain. {ECO:0000250|UniProtKB:Q9QYI6} 91..222 35/152 (23%)
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 75/218 (34%)
DnaJ 4..65 CDD:278647 37/61 (61%)
DnaJ_C 174..338 CDD:199909 8/35 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.