DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tbxas1 and Cyp6a8

Sequence 1:NP_036819.1 Gene:Tbxas1 RGDID:3826 Length:533 Species:Rattus norvegicus
Sequence 2:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster

Alignment Length:534 Identity:144/535 (27%)
Similarity:258/535 (48%) Gaps:51/535 (10%)


  Rat    14 TVVTVTLSVVLLALLKWYSTSAFSRLRKLGIRHPEPSPFVGNLMFFRQG------FWESHLELRE 72
            |.:...::|.|||:|.:|.....:..::.||....|....||:...::.      |.:.:.:.||
  Fly     4 TYILFQVAVALLAILTYYIHRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQDHYNKFRE 68

  Rat    73 RYGPLCGYYLGRRMYIVISDPDMIKEVLVENFSNFSNRMASGL------EPKLIADSVLMLRDRR 131
            ...|..|::..:.....:.|.::.|::|:::||||||:   |:      :|  |:..:..|...:
  Fly    69 SKAPFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNK---GIFYNEKDDP--ISAHLFNLDGAQ 128

  Rat   132 WEEVRGALMSAFSPEKLNEMTPLISQACELLLSHLKHSAASGDAFDIQRCYCCFTTNVVASVAFG 196
            |..:|..|.|.|:..|:..|.|.:.......::.:..........:|:.....||.:|:.:.|||
  Fly   129 WRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVLEIRDLVARFTVDVIGTCAFG 193

  Rat   197 IEVNSQDAPEDPFVQHCQRVFAFSTPRPLL-ALILSFPSIMVPLARILPNKNRDELNGFFNTLIR 260
            |:.||....:..|:...:|.........|| ..:.|:|.:...|..:   :....:..|::.::.
  Fly   194 IQCNSLRDEKAEFLYFGKRSLVDKRHGTLLNGFMRSYPKLARKLGMV---RTAPHIQEFYSRIVT 255

  Rat   261 NVIALRDKQTAEERRGDFLQMVLDAQRSMSSVGVEAFDMVTEALSSAECMGDPPQRCHPTSTAKP 325
            ..:|:|:|:  ..:|.||:.|:::. ::...:.:|..|:|                       :.
  Fly   256 ETVAVREKE--HIKRNDFMDMLIEL-KNQKEMTLENGDVV-----------------------RG 294

  Rat   326 LTVDEIAGQAFLFLIAGHEITTNTLSFITYLLATHPECQERLLKEVDLFMEKHPAPEYCNLQEGL 390
            ||::|:..|||:|.|||.|.:::|:.|..|.||.:|:.|:::..||:..:|:|.........:.|
  Fly   295 LTMEEVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQHDQNFTYECTKDL 359

  Rat   391 PYLDMVVAETLRMYPPAFRFTREAAQDCEVLGQH---IPAGSVLEIAVGALHHDPEHWPNPETFD 452
            .||:.|:.||||:|.......|.||:...|.|..   |.||..:.|...|:||||..:|.|..|.
  Fly   360 KYLNQVLDETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYPEPFEFR 424

  Rat   453 PERFTAEARLQQKPFTYLPFGAGPRSCLGVRLGLLVVKLTLLQVLHKFRFEACPETQVPLQLESK 517
            ||||:.|....:....:||||.|||:|:|:|.|.:..::.|..::..|:|..|.:|..||..:.|
  Fly   425 PERFSPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCSKTPNPLVYDPK 489

  Rat   518 S-ALCPKNGVYVKI 530
            | .|..|:|:|:|:
  Fly   490 SFVLGVKDGIYLKV 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tbxas1NP_036819.1 p450 47..530 CDD:278495 135/500 (27%)
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 135/498 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H130979
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T131170
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.665 Consistency score
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.