DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ucp1 and CG1907

Sequence 1:NP_036814.1 Gene:Ucp1 RGDID:3931 Length:307 Species:Rattus norvegicus
Sequence 2:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster

Alignment Length:308 Identity:93/309 (30%)
Similarity:151/309 (49%) Gaps:21/309 (7%)


  Rat     2 VSSTTSEVQP-----TMGVKIFSAGVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLGT 61
            :|:|:.:..|     |..:|....|:|...|.::..|||..|.|:||.|.|  |....|:..|..
  Fly     1 MSATSVQEAPKKAVATNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAG--SGKKEYRSSLHC 63

  Rat    62 ITTLAKTEGLPKLYSGLPAGIQRQISFASLRIGLYDTVQEYFSSGRETPASLGSKISAGLMTGGV 126
            |.|:...||...||.|:.|.:.||.::.:.|:|:|..:.:.|....:....:...::.|.:.|..
  Fly    64 IQTIVSKEGPLALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGAC 128

  Rat   127 AVFIGQPTEVVKVRMQAQSHLHGIKPR-YTGTYNAYRVIATTESLSTLWKGTTPNLMRNVIINCT 190
            ..|||.|.||..|||.:...|...:.| ||...||...|...|.|:.||:|:.|.:.|.:::|.|
  Fly   129 GAFIGTPAEVALVRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMT 193

  Rat   191 ELVTYDLMK-----GALVNHHILADDVPCHLLSALVAGFCTTLLASPVDVVKTRFIN--SLPG-- 246
            :|.:|...|     |.|.    :.:.:..|..:::::|..||:.:.|:|:.|||..|  .:.|  
  Fly   194 QLASYSQFKTYFRHGPLQ----MEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKP 254

  Rat   247 QYPSVPSCAMTMYTKEGPAAFFKGFAPSFLRLGSWNVIMFVCFEQLKK 294
            :|.......:.:..:||..|.:|||.|.:.|||...|:.|:..|||.:
  Fly   255 EYRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQ 302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ucp1NP_036814.1 Mito_carr 10..103 CDD:278578 31/98 (32%)
Solcar 1 11..102 31/96 (32%)
PTZ00169 21..297 CDD:240302 88/285 (31%)
Mito_carr 110..205 CDD:278578 32/101 (32%)
Solcar 2 111..201 31/96 (32%)
Solcar 3 210..295 27/90 (30%)
Mito_carr 215..300 CDD:278578 27/85 (32%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 31/95 (33%)
Mito_carr 118..207 CDD:278578 30/89 (34%)
Mito_carr 219..307 CDD:278578 27/85 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.