DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tcp1 and CCT1

Sequence 1:NP_036802.1 Gene:Tcp1 RGDID:3832 Length:556 Species:Rattus norvegicus
Sequence 2:NP_524450.2 Gene:CCT1 FlyBaseID:FBgn0003676 Length:557 Species:Drosophila melanogaster

Alignment Length:555 Identity:406/556 (73%)
Similarity:475/556 (85%) Gaps:2/556 (0%)


  Rat     1 MEGPLSVFGDRSTGEAIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLL 65
            :..|||:.|.|.:|.::|:||||||.||:||||||||||||||||||||||||:||||||||:||
  Fly     4 LASPLSIAGTRQSGASVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVTNDGATILRLL 68

  Rat    66 EVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVR 130
            ||||||||||.|||.|||:|||||||||||:||||||||||||||||||||:|||||:|||||.:
  Fly    69 EVEHPAAKVLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGYRIACKEACK 133

  Rat   131 YINENLIINTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAVKYTDIRGQPRYPVNSV 195
            ||:|:|....||||||.|||.|||||||||||.:.:||:.|||||..:||.||.|||..|.:.::
  Fly   134 YISEHLTAPVDELGRDSLINIAKTSMSSKIIGADAEFFSAMVVDAAQSVKITDPRGQAAYSIKAI 198

  Rat   196 NILKAHGRSQIESMLINGYALNCVVGSQGMLKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKL 260
            |:|||||:|..||:||.||||||.:.||.|.|:|||||||||||||||||||:||||:|.||:||
  Fly   199 NVLKAHGKSARESVLIPGYALNCTIASQQMPKKIVNAKIACLDFSLQKTKMKMGVQVLINDPDKL 263

  Rat   261 DQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFVEAGAMAVRRVLKRDLKRIAKASGA 325
            :.||.||.|||||||..||.||.||:|.:||:||:|:||||||||||||||.|.|||.||||:||
  Fly   264 EAIRARELDITKERINMILGTGVNVVLVSGGVDDLCMKYFVEAGAMAVRRVKKSDLKIIAKATGA 328

  Rat   326 SILSTLANLEGEETFEATMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMER 390
            :.:::|.|::|||:|:|:|:|:|.||.|||||||||||||.||||.:|||||||.|||.||||||
  Fly   329 AFITSLTNMDGEESFDASMVGEAAEVAQERICDDELILIKGTKARAAASIILRGPNDFYCDEMER 393

  Rat   391 SLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVN 455
            |:||||||||||||||.||.|||.|||||||||||:|||:.|||||||||||:||||||.||:||
  Fly   394 SVHDALCVVKRVLESKKVVAGGGCVEAALSIYLENFATSLASREQLAIAEFAKSLLVIPKTLSVN 458

  Rat   456 AAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLVHGKPRDNKQAGVFEPTIVKVKSLKFATEA 520
            ||:|:||||||||::||.:|..|||.:|||.||||:.|..||||:|||.||.:.|:|||||||||
  Fly   459 AAKDATDLVAKLRSYHNSSQTKPERSDLKWTGLDLIEGVVRDNKKAGVLEPAMSKIKSLKFATEA 523

  Rat   521 AITILRIDDLIKLHPESKDDKHGGYENAVHSGALD 555
            |||||||||:|||:||.|..|  .|.:|..:|.||
  Fly   524 AITILRIDDMIKLNPEDKSGK--SYADACAAGELD 556

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tcp1NP_036802.1 chap_CCT_alpha 5..540 CDD:274081 399/535 (75%)
TCP1_alpha 9..535 CDD:239451 394/526 (75%)
CCT1NP_524450.2 chap_CCT_alpha 8..543 CDD:274081 399/535 (75%)
TCP1_alpha 12..538 CDD:239451 394/526 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C158995533
eggNOG 1 0.900 E1_COG0459
Hieranoid 1 1.000
Homologene 1 1.000 H5656
Inparanoid 1 1.050 798 1.000 Inparanoid score I471
OMA 1 1.010
OrthoDB 1 1.010 D205390at33208
OrthoFinder 1 1.000 FOG0004421
OrthoInspector 1 1.000 T1086227
orthoMCL 1 0.900 OOG5_127998
Panther 1 1.100 LDO PTHR11353
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.