DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56f and Obp83a

DIOPT Version :10

Sequence 1:NP_725926.1 Gene:Obp56f / 246668 FlyBaseID:FBgn0043533 Length:125 Species:Drosophila melanogaster
Sequence 2:NP_001287190.1 Gene:Obp83a / 40737 FlyBaseID:FBgn0011281 Length:174 Species:Drosophila melanogaster


Alignment Length:106 Identity:24/106 - (22%)
Similarity:46/106 - (43%) Gaps:17/106 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ACLKRQLGYT---ITENTKFDAKEDSLQSKCFYHCLL-EVKGVIANDAISSEQPRKVLEKKYG-- 86
            ||::: .|.|   |.|.:..:..||. :.||:.:|.. |::.|..|..:.       |||.:.  
  Fly    74 ACVEK-TGVTEAAIKEFSDGEIHEDE-KLKCYMNCFFHEIEVVDDNGDVH-------LEKLFATV 129

  Fly    87 -ITDTDELEKAEEKCHSIKASGKCELGYEILKCYQSI-TKH 125
             ::..|:|.:..:.|...:....|...:...:|::.. .||
  Fly   130 PLSMRDKLMEMSKGCVHPEGDTLCHKAWWFHQCWKKADPKH 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56fNP_725926.1 PBP_GOBP <49..120 CDD:460193 15/74 (20%)
Obp83aNP_001287190.1 PhBP 71..167 CDD:214783 22/101 (22%)

Return to query results.
Submit another query.