DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56f and Obp47a

DIOPT Version :10

Sequence 1:NP_725926.1 Gene:Obp56f / 246668 FlyBaseID:FBgn0043533 Length:125 Species:Drosophila melanogaster
Sequence 2:NP_610632.1 Gene:Obp47a / 36162 FlyBaseID:FBgn0033573 Length:165 Species:Drosophila melanogaster


Alignment Length:104 Identity:31/104 - (29%)
Similarity:51/104 - (49%) Gaps:9/104 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SSEKIKACLKRQLGYTITENTKF---DAKEDSLQSKCFYHCLLEVKGVIANDAISSEQPRKVLEK 83
            :.|.|:.| ..|...::.|..|.   |..:.|...:||.|||.|..|:: :|.:..|  |.:...
  Fly    41 TEEMIRLC-GDQTDISLRELNKLQREDFSDPSESVQCFTHCLYEQMGLM-HDGVFVE--RDLFGL 101

  Fly    84 KYGITDTDELEKAEEKCHSIKASGKCELGYEILKCYQSI 122
            ...:::||..  .|.:||:|:.:.|||..|.|.:|.|.:
  Fly   102 LSDVSNTDYW--PERQCHAIRGNNKCETAYRIHQCQQQL 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56fNP_725926.1 PBP_GOBP <49..120 CDD:460193 23/70 (33%)
Obp47aNP_610632.1 PhBP 44..132 CDD:214783 27/93 (29%)

Return to query results.
Submit another query.