DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56f and Obp8a

DIOPT Version :10

Sequence 1:NP_725926.1 Gene:Obp56f / 246668 FlyBaseID:FBgn0043533 Length:125 Species:Drosophila melanogaster
Sequence 2:NP_727322.1 Gene:Obp8a / 31860 FlyBaseID:FBgn0030103 Length:163 Species:Drosophila melanogaster


Alignment Length:48 Identity:13/48 - (27%)
Similarity:22/48 - (45%) Gaps:10/48 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 MKSSEKIKACLK------RQLGYTITENTKFDAK--EDSLQSKCFYHC 59
            |:||.:..|.|:      |:|  |..:..:.|..  ||:...:.:.||
  Fly    31 MRSSPQSLALLRARDQCGREL--TAAQRLQLDRMQFEDAAHVRHYLHC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56fNP_725926.1 PBP_GOBP <49..120 CDD:460193 3/11 (27%)
Obp8aNP_727322.1 PhBP 43..144 CDD:214783 8/36 (22%)

Return to query results.
Submit another query.