DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56i and Obp99a

DIOPT Version :10

Sequence 1:NP_725929.1 Gene:Obp56i / 246667 FlyBaseID:FBgn0043532 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_651707.1 Gene:Obp99a / 43488 FlyBaseID:FBgn0039678 Length:142 Species:Drosophila melanogaster


Alignment Length:109 Identity:19/109 - (17%)
Similarity:44/109 - (40%) Gaps:6/109 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KDQCMAAAGITAQDVANRHETDDPGHS-VKCFFRCFLENIGI--IADNQIIPGAFDRVLG-HIVT 87
            :|:|:....:....|....:.:.|..: .:|:.:|.....|:  :.....:.....:::| |...
  Fly    30 RDECVKELAVPVDLVEKYQKWEYPNDAKTQCYIKCVFTKWGLFDVQSGFNVENIHQQLVGNHADH 94

  Fly    88 AEAVERMEATCNMIKSETSHDESCEFAWQISECYEGVRLSDVKK 131
            .||.....|.|  :........:||:|::.:.|.....|:.::|
  Fly    95 NEAFHASLAAC--VDKNEQGSNACEWAYRGATCLLKENLAQIQK 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56iNP_725929.1 PBP_GOBP 25..121 CDD:460193 16/97 (16%)
Obp99aNP_651707.1 PhBP 29..130 CDD:214783 17/101 (17%)

Return to query results.
Submit another query.