DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56i and Obp47a

DIOPT Version :10

Sequence 1:NP_725929.1 Gene:Obp56i / 246667 FlyBaseID:FBgn0043532 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_610632.1 Gene:Obp47a / 36162 FlyBaseID:FBgn0033573 Length:165 Species:Drosophila melanogaster


Alignment Length:82 Identity:20/82 - (24%)
Similarity:38/82 - (46%) Gaps:6/82 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RHETDDPGHSVKCFFRCFLENIGIIADNQIIPGAFDRVLGHIVTAEAVERMEATCNMIKSETSHD 108
            |.:..||..||:||..|..|.:|::.|...:......:|..:...:...  |..|:.|:.    :
  Fly    64 REDFSDPSESVQCFTHCLYEQMGLMHDGVFVERDLFGLLSDVSNTDYWP--ERQCHAIRG----N 122

  Fly   109 ESCEFAWQISECYEGVR 125
            ..||.|::|.:|.:.::
  Fly   123 NKCETAYRIHQCQQQLK 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56iNP_725929.1 PBP_GOBP 25..121 CDD:460193 19/76 (25%)
Obp47aNP_610632.1 PhBP 44..132 CDD:214783 18/73 (25%)

Return to query results.
Submit another query.